DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and AT1G25460

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001319080.1 Gene:AT1G25460 / 839132 AraportID:AT1G25460 Length:319 Species:Arabidopsis thaliana


Alignment Length:277 Identity:60/277 - (21%)
Similarity:112/277 - (40%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHWLG--------HENFELIHHDI-VN 174
            |:|||..|:.||::..|:..||.|      .|..:.:.|..:|        .|..::...|: :.
plant     5 LVTGGTSFIASHVIKSLLEFGHYV------RTTVRDSDEEKVGFLWDLKGAKERLKIFEADLTIE 63

  Fly   175 PLFIE----IDEIYHLASPASPPHYMYNPVKTIKTNTMGTINVL---GLAKRVMAKVLIASTSEV 232
            ..|.|    :|.::|:||..| .....|.:.....|..||:||:   ..::..:.::::.|:|..
plant    64 GSFDEAVNGVDGVFHIASRVS-VRLDNNNLDKFDPNISGTMNVMNSCAKSRNTVKRIVLTSSSTA 127

  Fly   233 ----YGDPTVHPQPETYWGHVNPIGPRAC------YDEGKRVSETLSYAYAKQEKVQVRVARIFN 287
                :....|.|..|::|..:     ..|      |...|.:.|..::..|..:|:.:.|.....
plant   128 IRYRFDATQVSPLNESHWTDL-----EYCKHFKIWYAYKKTLGEKEAWRIAADKKLNLVVVIPSF 187

  Fly   288 TYGPRMHMNDGRVVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMIALMASNYTQPVNLGN 352
            ..||  .::.....|..|..::...|...|.|.:  ..|.::.|:|...|..|    .:|...|.
plant   188 CIGP--ILSPKPTSSPLIFLSIIKGTRGTYPNFR--GGFVHIDDVVAAQILAM----EEPKASGR 244

  Fly   353 PV-EQTIGEFAEIIKKL 368
            .: ..::..::|||:.|
plant   245 ILCSSSVAHWSEIIEML 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 60/277 (22%)
UGD_SDR_e 116..419 CDD:187541 60/277 (22%)
AT1G25460NP_001319080.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D848823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.