DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and AT4G27250

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_194455.2 Gene:AT4G27250 / 828833 AraportID:AT4G27250 Length:354 Species:Arabidopsis thaliana


Alignment Length:353 Identity:74/353 - (20%)
Similarity:133/353 - (37%) Gaps:87/353 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 ITGGAGFVGSHLVDDLMVQGHEV------IVVDNFFTGRKRNVEHWLGHENFELIHHDIVNPLFI 178
            :||.:|::||.||..|:.:|:.|      :....:|..:      |..:|...|...|:.:....
plant    15 VTGASGYIGSWLVKSLLQRGYTVHATLRDLAKSEYFQSK------WKENERLRLFRADLRDDGSF 73

  Fly   179 E-----IDEIYHLAS----PASPPHY---MYNPVKTIKTNTMGTINVLG---LAKRVMAKVLIAS 228
            :     .|.::|:|:    ..|..|.   .|...|.|:....|..|||.   .:|.|...|..:|
plant    74 DDAVKGCDGVFHVAASMEFDISSDHVNLESYVQSKVIEPALKGVRNVLSSCLKSKSVKRVVFTSS 138

  Fly   229 TSEVYGDPTVHPQ--------PETYWGHVNPI----GPRACYDEGKRVSETLSYAYAKQEKVQVR 281
            .|.:    |...:        .||...||:.:    .....|...|.|||..::.|||:..:.: 
plant   139 ISTL----TAKDENERMRSFVDETCKAHVDHVLKTQASGWIYVLSKLVSEEEAFRYAKERGMDL- 198

  Fly   282 VARIFNTYGPRMHMNDGRVVSNFILQALRNETITVYGNGK------------QTRSFQYVSDLVD 334
            |:.|..|.       .|..::.|:..:::.....:.|:.|            .:.:..::.|:..
plant   199 VSVITTTV-------SGPFLTPFVPSSVQVLLSPITGDSKLFAILSAVNKRMGSIALVHIEDICR 256

  Fly   335 GMIALMASNYTQPVNLGNPV---------EQTIGEFAEIIKKLVGGPSVIKQSKAMEDDPQRR-- 388
            ..:.||    .||...|..:         |..:..|::        ..:.|..|..||:.:|.  
plant   257 AHLFLM----EQPKAKGQYICCVDNIDMHELMLHHFSK--------DYLCKVQKVNEDEEERECM 309

  Fly   389 KPDITRAR-QLLHWEPKVPLETGLQRTI 415
            ||.|:..: :.|.:|.|..:|..:.:||
plant   310 KPIISSKKLRELGFEYKYGIEEIVDQTI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 74/353 (21%)
UGD_SDR_e 116..419 CDD:187541 74/353 (21%)
AT4G27250NP_194455.2 PLN02896 1..354 CDD:178484 74/353 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D848823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.