DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and HSD3B7

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_079469.2 Gene:HSD3B7 / 80270 HGNCID:18324 Length:369 Species:Homo sapiens


Alignment Length:276 Identity:59/276 - (21%)
Similarity:94/276 - (34%) Gaps:80/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHWLGHENFELIHHDI-VNPLFIEIDE 182
            |:|||.||:|.|:|..|:.:...:        |..|..:..||....||....: |..:..::.:
Human    13 LVTGGCGFLGEHVVRMLLQREPRL--------GELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQ 69

  Fly   183 IYHLASPASPPHYMYNPV-----------KTI-KTNTMGTINVLGLAKRVMAKVLI-ASTSEVYG 234
            .:.:|:..:..|.:.:..           ||| :.|..||.||:....:...:.|: .|:.||.|
Human    70 AHEVAAAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVG 134

  Fly   235 DPTV-HPQPETYWG---------HVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTY 289
            ..|. ||   .|.|         |.:|      |...|.::|.|.                    
Human   135 PNTKGHP---FYRGNEDTPYEAVHRHP------YPCSKALAEWLV-------------------- 170

  Fly   290 GPRMHMNDGRVVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMIALMASNYTQPVNLGNPV 354
               :..|..:|.....|.........:||.|.|                :|...|.|.:.||..:
Human   171 ---LEANGRKVRGGLPLVTCALRPTGIYGEGHQ----------------IMRDFYRQGLRLGGWL 216

  Fly   355 EQTIGEFAEIIKKLVG 370
            .:.|....|..:..||
Human   217 FRAIPASVEHGRVYVG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 59/276 (21%)
UGD_SDR_e 116..419 CDD:187541 59/276 (21%)
HSD3B7NP_079469.2 3b-HSD_HSDB1_like_SDR_e 11..361 CDD:187671 59/276 (21%)
3Beta_HSD 13..291 CDD:279420 59/276 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.