DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and Tgds

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_083854.3 Gene:Tgds / 76355 MGIID:1923605 Length:355 Species:Mus musculus


Alignment Length:338 Identity:88/338 - (26%)
Similarity:154/338 - (45%) Gaps:57/338 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KRILITGGAGFVGSHLVDDLMVQGHEVIVV--DNF-FTGRKRNVEHWLGHENFELIHHDIVNPLF 177
            ||:|:||||||:.||::..|:....:.::|  |.. :....:|:|.....:|::.|..||.:..|
Mouse    18 KRVLVTGGAGFIASHVIVSLVEDYPDYMIVNLDKLDYCASLKNLEPVSNKQNYKFIQGDICDSHF 82

  Fly   178 I-------EIDEIYHLASPASPPHYMYNPVKTIK---TNTMGTINVLGLAKRV-MAKVLIASTSE 231
            :       :||.:.|.|:..   |...:.|:..:   .|..||..::..|... :.|.:..||.|
Mouse    83 VKLLFEVEKIDIVLHFAAQT---HVDLSFVRAFEFTYVNVYGTHVLVNAAYEAGVEKFIYVSTDE 144

  Fly   232 VYG-------DPTVHPQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTY 289
            |||       |.:...||      .||      |...|..:|....:|.::.|..|.:.|..|.|
Mouse   145 VYGGSLDQEFDESSPKQP------TNP------YASSKAAAECFVQSYWERYKFPVVITRSSNVY 197

  Fly   290 GPRMHMNDGRVVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMIALMASNYTQPV-NLGNP 353
            ||  |....:|:..||.....|....::|:|.|.|:|.|.:|:|:..:.::.......: |:|..
Mouse   198 GP--HQYPEKVIPKFISLLQHNRKCCIHGSGLQRRNFLYAADVVEAFLTVLTKGEPGEIYNIGTN 260

  Fly   354 VEQTIGEFAEIIKKLVGGPSVIKQSKA----------MEDDPQR--RKPDITRARQLLHWEPKVP 406
            .|.::   .::.|:|:   .:||::.:          :.|.|..  |.|..:.....|.|:||||
Mouse   261 FEMSV---VQLAKELI---QLIKETNSESETESWVDYVSDRPHNDMRYPMKSEKIHSLGWKPKVP 319

  Fly   407 LETGLQRTISYFR 419
            .|.|:::|:.::|
Mouse   320 WEEGIKKTVEWYR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 88/338 (26%)
UGD_SDR_e 116..419 CDD:187541 87/336 (26%)
TgdsNP_083854.3 RfbB 18..340 CDD:224013 88/338 (26%)
dTDP_GD_SDR_e 18..336 CDD:187557 88/338 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289613at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1867
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.