DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and Sdr42e1

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001344201.1 Gene:Sdr42e1 / 74032 MGIID:1921282 Length:394 Species:Mus musculus


Alignment Length:372 Identity:84/372 - (22%)
Similarity:144/372 - (38%) Gaps:100/372 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHWLGHENFELIHHDI-----VNPLF 177
            :|||||.|:.|..|...|..:|..||:.|  .|...:|:.     |..:.:..||     |...|
Mouse    11 VLITGGGGYFGFRLGCALNQKGARVILFD--ITQPAQNLP-----EGIKFVCGDIRCLADVETAF 68

  Fly   178 IEIDE---IYHLASPASPPHYMYNPVKTIKTNTMGTINVL-GLAKRVMAKVLIASTSEVY----- 233
            .:.::   ::|:||.........|..:..:.|..||.|:| ...:|.:.:::..||..|.     
Mouse    69 QDAEKVACVFHVASYGMSGREQLNKTQIEEVNVGGTENILRACLERGVPRLVYTSTFNVIFGGQV 133

  Fly   234 ---GDPT-----VHPQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKV----QVRVARIF 286
               ||.:     :|..|:.|        .|......|:|.|....|:.:.:.:    .:|.|.|:
Mouse   134 IRNGDESLPYLPLHLHPDHY--------SRTKSIAEKKVLEANGLAFKQGDGILRTCAIRPAGIY 190

  Fly   287 NTYGPRMHMNDGRVVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMI----AL------MA 341
            .. |.:.|:  .|:|| :|.:.|..   .|||:.:....|.:|.:|....|    ||      :|
Mouse   191 GA-GEQRHL--PRIVS-YIERGLFR---FVYGDPQSLVEFVHVDNLAKAHILASEALKADKGHVA 248

  Fly   342 SNYTQPVNLGNPVEQTIGEFAEIIKKLVGG-----PS-------------VIKQSKAMEDDPQRR 388
            |.....::.|.||..     .|..:.||.|     ||             :::.:..:.......
Mouse   249 SGQPYFISDGRPVNN-----FEFFRPLVEGLGYTFPSTRLPLTLIYCLAFLVEMTHFIVGRLYNF 308

  Fly   389 KPDITR----------------ARQLLHWEPKVPLETGLQRTISYFR 419
            :|.:||                |::.|.:||: |.:  ||..:.:|:
Mouse   309 QPFLTRTEVYKTGVTHYFSLEKAKKELGFEPQ-PFD--LQEVVEWFK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 84/372 (23%)
UGD_SDR_e 116..419 CDD:187541 83/370 (22%)
Sdr42e1NP_001344201.1 NADB_Rossmann 10..351 CDD:389744 83/369 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.