DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and GFUS

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001304712.1 Gene:GFUS / 7264 HGNCID:12390 Length:327 Species:Homo sapiens


Alignment Length:331 Identity:77/331 - (23%)
Similarity:133/331 - (40%) Gaps:36/331 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHW--LGHENFELIHHDIVNPLF-- 177
            |||:|||:|.||..:         :.:|.|    |.....|.|  :..::.:|........||  
Human    15 RILVTGGSGLVGKAI---------QKVVAD----GAGLPGEDWVFVSSKDADLTDTAQTRALFEK 66

  Fly   178 IEIDEIYHLASPASP--PHYMYNPVKTIKTNTMGTINVLGLAKRVMAKVLIASTSE-VYGDPTVH 239
            ::...:.|||:....  .:..|| :...:.|.....|||..|..|.|:.:::..|. ::.|.|.:
Human    67 VQPTHVIHLAAMVGGLFRNIKYN-LDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTY 130

  Fly   240 PQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTYGPRMHMN--DGRVVS 302
            |..||...:..|......|...||:.:..:.||.:|...........|.:||..:.|  ||.|:.
Human   131 PIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLP 195

  Fly   303 NFI----LQALRNETITVYGNGKQTRSFQYVSDLVDGMI-ALMASNYTQPV--NLGNPVEQTIGE 360
            ..|    |.......:||:|.|...|.|.|..||....| .|...|..:|:  ::|...|.:|.|
Human   196 GLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKE 260

  Fly   361 FAEIIKKLVGGPSVIKQSKAMEDDPQRRKPDITRARQLLHWEPKVPLETGLQRTISYFRNELARS 425
            .||.:.:.:.....:.......|...::....::.|..|......|.:..::.|.::|      :
Human   261 AAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWF------T 319

  Fly   426 DRFQES 431
            |.::::
Human   320 DNYEQA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 76/322 (24%)
UGD_SDR_e 116..419 CDD:187541 75/317 (24%)
GFUSNP_001304712.1 GDP_FS_SDR_e 15..318 CDD:187550 75/316 (24%)
Epimerase 16..251 CDD:279681 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.