DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and ZC449.7

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001123192.1 Gene:ZC449.7 / 6418874 WormBaseID:WBGene00045365 Length:189 Species:Caenorhabditis elegans


Alignment Length:134 Identity:27/134 - (20%)
Similarity:42/134 - (31%) Gaps:43/134 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 NETITVYGNGKQTRSFQYVSDLVDGMIALMASNYTQPVNLG-NPVEQTIG--EFAEIIKKLVGGP 372
            |...|||.:..:.||.:..|           :|:..|:.:. .|:|..|.  :|           
 Worm    12 NTNNTVYSDDVRPRSQETTS-----------TNFQTPLTITIPPIEYDIPACQF----------- 54

  Fly   373 SVIKQSKAMEDDPQRRKPDITRARQLLHWEPKVPLETGLQRTISYFRNELARSDR----FQESSN 433
                          .::|.:|.....|....|:..|.|.|.|...|..|.|.:..    ||....
 Worm    55 --------------NQQPLLTSKSPELDALVKLNKEIGNQYTYQMFDVEKASNSNHHLGFQNDPR 105

  Fly   434 KYFD 437
            ..:|
 Worm   106 MAYD 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 23/115 (20%)
UGD_SDR_e 116..419 CDD:187541 21/110 (19%)
ZC449.7NP_001123192.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.