DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and hsd3b1

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001373226.1 Gene:hsd3b1 / 553532 ZFINID:ZDB-GENE-081105-30 Length:374 Species:Danio rerio


Alignment Length:393 Identity:78/393 - (19%)
Similarity:135/393 - (34%) Gaps:126/393 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LITGGAGFVGSHLVDDLMVQGH--EVIVVDNFFTGRKRNVEHWL--------GHENFELIHHDIV 173
            ::||..||:|..||..|:.:..  |:.::|       ||:...|        |.....:...||.
Zfish     9 VVTGACGFLGERLVRLLLKEEKLAEIRLLD-------RNIRSELIQSLDDCRGETKVSVFEGDIR 66

  Fly   174 NPLFIE-----IDEIYHLASPASPPHYMYNPVKTIKTNTMGTINVLGLAKRVMAKVLI------- 226
            ||..:.     ...::|.||       :.:.:..::.:.:..:||  .|.:::.:..|       
Zfish    67 NPELLRRACKGAALVFHTAS-------LIDVIGAVEYSELYGVNV--KATKLLLETCIQENVPSF 122

  Fly   227 --ASTSEVYGDPTVHPQPETYWGHVNPIG-PRACYDEGKRVSETLSYAYAKQEKVQVRVA----- 283
              .|:.||.|.              ||.| |....:|....|..|.::|:|.:|....:.     
Zfish   123 IYTSSIEVAGP--------------NPSGEPIINGNEDTPYSSRLKFSYSKTKKEAEEICLQANG 173

  Fly   284 --------------RIFNTYGPRM-----HMNDGRVVSNFILQALRNETIT--VY-GN------- 319
                          |....:||..     ||.||....|.:|:..|.|...  || ||       
Zfish   174 DLLCNGGQLATCALRPMYIFGPGCRFTLGHMRDGIRNGNVLLRTSRREAKVNPVYVGNAALAHLQ 238

  Fly   320 -GKQTR----------SFQYVSDLVDGMIALMASNYTQPVNLGNPVEQ----------TIGEFAE 363
             |:..|          :|.|:||... .::....||....:||..:::          .:..|.|
Zfish   239 AGRGLRDPQKRAMMGGNFYYISDNTP-HVSYSDFNYAVLSSLGFGIQERPILPFPLLYILSFFME 302

  Fly   364 IIKK-----LVGGPSVIKQSKAMEDDPQRRKPDITRARQLLH----WEPKVPLETGLQRTISYFR 419
            ::..     |...|.:.:|...|.:.|      .:.:.|..|    :.|:...|...:.|..:|.
Zfish   303 LLHVVLRPFLTFTPPLNRQLLTMLNTP------FSFSYQKAHRDFGYTPRYEWEEARKCTTDWFA 361

  Fly   420 NEL 422
            :.|
Zfish   362 SVL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 78/393 (20%)
UGD_SDR_e 116..419 CDD:187541 76/388 (20%)
hsd3b1NP_001373226.1 NADB_Rossmann 7..360 CDD:419666 76/387 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.