DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and gfus.3

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001070752.2 Gene:gfus.3 / 550486 ZFINID:ZDB-GENE-050417-317 Length:344 Species:Danio rerio


Alignment Length:348 Identity:74/348 - (21%)
Similarity:128/348 - (36%) Gaps:77/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHW--LGHENFELIHHDIVNPLFIE 179
            |:|:|||:|.||..:...:..:|              |..|.|  |..:...|:.......:|.:
Zfish    33 RVLVTGGSGLVGRAIERVVKEEG--------------RGGEEWTFLSSKEANLLSAKETRAIFEK 83

  Fly   180 I--DEIYHLASPASPPHYMYNPVKT----------IKTNTMGTINVLGLAKRVMAKVLIASTSEV 232
            .  ..:.|||:....   ::..::.          |..|.:.|.|..|     :.||:...::.:
Zfish    84 YRPTHVIHLAAMVGG---LFRNMRQNLDFWRNNVFINDNVLQTANEFG-----VVKVVSCLSTCI 140

  Fly   233 YGDPTVHPQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTYGPR----- 292
            :.|.|.:|..||            ....|........||:||: .:.|:....|..||.|     
Zfish   141 FPDKTTYPIDET------------MIHNGPPHDSNFGYAFAKR-MIDVQNRTCFKQYGRRYTAGI 192

  Fly   293 ----------MHMNDGRVVSNFI----LQALRNETITVYGNGKQTRSFQYVSDLVDGMI-ALMAS 342
                      .::.||.|:...|    |.....:.:.|:|:||..|.|.|..||....: .|...
Zfish   193 LTNVFGAHDNFNIEDGHVLPGLIHKTYLAKKEGKPLQVWGSGKPLRQFIYSLDLARLFLWVLREY 257

  Fly   343 NYTQPV--NLGNPVEQTIGEFAEIIKKLVG--GPSVIKQSKAMEDDPQRRKPDITRARQLLHWEP 403
            :...|:  ::|...|.:|.:.|:.:...:|  |..:...|||  |...::.....:.||.|....
Zfish   258 DEVDPIILSVGEEDELSIKDCADAVVDALGFNGDVIYDTSKA--DGQFKKTASNAKLRQYLPDFQ 320

  Fly   404 KVPLETGLQRTISYF--RNELAR 424
            ..|....::.|..:|  ..::||
Zfish   321 FTPFREAIKETCDWFVANYDIAR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 72/346 (21%)
UGD_SDR_e 116..419 CDD:187541 72/341 (21%)
gfus.3NP_001070752.2 GDP_FS_SDR_e 33..335 CDD:187550 71/338 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.