DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and NSDHL

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_016885053.1 Gene:NSDHL / 50814 HGNCID:13398 Length:389 Species:Homo sapiens


Alignment Length:390 Identity:91/390 - (23%)
Similarity:155/390 - (39%) Gaps:83/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RENLARLEEQVRSLQTSTPRKYPKVKYLNYKNRKRILITGGAGFVGSHLVDDLMVQGHEVIVVD- 146
            |:.:||..     |...||:....::.:|....||..:.||:||:|.|:|:.|:.:|:.|.|.| 
Human    26 RDQVARTH-----LTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDI 85

  Fly   147 ---------NFFTGRKRNVEHWLGHENFELIHHDIVNPLFIEIDEIYHLASPASPPHYMYNPVKT 202
                     .||.|              :|.....:.|....::.::|.|||  ||. ..|....
Human    86 QQGFDNPQVRFFLG--------------DLCSRQDLYPALKGVNTVFHCASP--PPS-SNNKELF 133

  Fly   203 IKTNTMGTINVLGLAKR--VMAKVLIASTSEVYGDPTVHPQPETYWGHVNPIGPRACYDEGKRVS 265
            .:.|.:||.||:...|.  |...:|.:|.|.::....:....|.....:.||.   .|.|.|.:.
Human   134 YRVNYIGTKNVIETCKEAGVQKLILTSSASVIFEGVDIKNGTEDLPYAMKPID---YYTETKILQ 195

  Fly   266 ETLSYAYAKQEKVQVRVA-RIFNTYGPRMHMNDGRVVSNFILQALRNETIT-VYGNGKQTRSFQY 328
            |.........||..:..| |....:|||    |.::|. .:::|.||..:. |.||||....|.:
Human   196 ERAVLGANDPEKNFLTTAIRPHGIFGPR----DPQLVP-ILIEAARNGKMKFVIGNGKNLVDFTF 255

  Fly   329 VSDLVDGMIALMASNYTQPVNLGNPVEQTIGE----FAEIIKKLVGG----------P------- 372
            |.::|.|.| |.|...::...||........:    |...:.:::.|          |       
Human   256 VENVVHGHI-LAAEQLSRDSTLGGKAFHITNDEPIPFWTFLSRILTGLNYEAPKYHIPYWVAYYL 319

  Fly   373 SVIKQSKAMEDDPQ-RRKPDIT----------------RARQLLHWEPKVPLETGLQRTISYFRN 420
            :::.....|...|. :.:|..|                ||::.:.::|.|.::..::||:..||:
Human   320 ALLLSLLVMVISPVIQLQPTFTPMRVALAGTFHYYSCERAKKAMGYQPLVTMDDAMERTVQSFRH 384

  Fly   421  420
            Human   385  384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 84/357 (24%)
UGD_SDR_e 116..419 CDD:187541 82/354 (23%)
NSDHLXP_016885053.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.