DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and gfus.1

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001008620.1 Gene:gfus.1 / 494077 ZFINID:ZDB-GENE-040722-1 Length:318 Species:Danio rerio


Alignment Length:319 Identity:69/319 - (21%)
Similarity:130/319 - (40%) Gaps:32/319 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHW--LGHENFELIHHDIVNPLFIE 179
            |:|:|||:|.||..:         |.:|.:    |..|..|.|  |..::..|:..:....:|.:
Zfish     6 RVLVTGGSGLVGRAI---------ERVVKE----GEGREGEEWIFLSSKDANLLSPEETKAVFEK 57

  Fly   180 --IDEIYHLASPASPP-HYMYNPVKTIKTNTMGTINVLGLA-KRVMAKVLIASTSEVYGDPTVHP 240
              ...:.|||:..... ..|...:...::|.....|||..| ...:.||:...::.::.|.|.:|
Zfish    58 HRPTHVIHLAAMVGGLFRNMRQNLDFWRSNVFINDNVLQAAHDSGVVKVVSCLSTCIFPDKTTYP 122

  Fly   241 QPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTYG--PRMHMNDGRVVSN 303
            ..||...:..|......|...||:.:..:.|:.:|...:.......|.:|  ...::.||.|:..
Zfish   123 IDETMIHNGPPHESNFGYAYAKRMIDVQNRAFFQQFNRRYTAVIPTNVFGCHDNFNIEDGHVLPG 187

  Fly   304 FI----LQALRNETITVYGNGKQTRSFQYVSDLVDGMI-ALMASNYTQPV--NLGNPVEQTIGEF 361
            .|    :.....:.:.|:|:|:..|.|.|..||....: .|...:..:|:  ::|...|.:|.:.
Zfish   188 LIHKTYIAKKEGKPLVVWGSGRPLRQFIYSLDLARLFVWVLREYDEVEPIILSVGEEDELSIKDA 252

  Fly   362 AEIIKKLV--GGPSVIKQSKAMEDDPQRRKPDITRARQLLHWEPKVPLETGLQRTISYF 418
            |:.:.:.:  .|..:...|||  |...::.....:.|:.|......|....::.|..:|
Zfish   253 ADAVVEALEFTGDVIYDTSKA--DGQFKKTASNAKLRKYLPDFKFTPFREAIKETCDWF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 69/319 (22%)
UGD_SDR_e 116..419 CDD:187541 69/319 (22%)
gfus.1NP_001008620.1 GDP_FS_SDR_e 6..309 CDD:187550 68/317 (21%)
Epimerase 7..242 CDD:279681 54/247 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.