DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and gfus.2

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001003528.1 Gene:gfus.2 / 445134 ZFINID:ZDB-GENE-041014-242 Length:328 Species:Danio rerio


Alignment Length:343 Identity:72/343 - (20%)
Similarity:131/343 - (38%) Gaps:64/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHW--LGHENFELIHHDIVNPLFIE 179
            |:|:|||:|.||..:         |.:|.:    |..|..|.|  |..:...|:..:.....|.:
Zfish    16 RVLVTGGSGLVGRAI---------ERVVKE----GEGREGEEWIFLSSKEANLVSAEQTRAAFEK 67

  Fly   180 --IDEIYHLASPASPPHYMYNPVKT----IKTNTMGTINVLGLAKRV-MAKVLIASTSEVYGDPT 237
              ...:.|||:....   :|..::.    .:.|.....|||.::... :.||:...::.|:.|.|
Zfish    68 HRPTHVIHLAAMVGG---LYRNMRQNLDFWRNNVHINDNVLNMSHEFGVVKVVSCLSTCVFPDKT 129

  Fly   238 VHPQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTYGPR---------- 292
            .:|..||            ...:|........|||||: .:.|....::..||.:          
Zfish   130 KYPIDET------------MMHDGAPHDSNYGYAYAKR-MIDVHNRALYQQYGRKYTAVIPTNMF 181

  Fly   293 -----MHMNDGRVVSNFI----LQALRNETITVYGNGKQTRSFQYVSDLVDGMIALMASNY--TQ 346
                 .::.||.|:...|    |.....:.:.|:|:|:..|.|.|..||. .:...:..||  .:
Zfish   182 GAHDNFNIEDGHVMPGLIHKTYLAKKEGKPLVVWGSGRALRQFIYSLDLA-RLFVWVLRNYDEVE 245

  Fly   347 P--VNLGNPVEQTIGEFAEIIKKLVGGPSVIKQSKAMEDDPQRRKPDITRARQLLHWEPKVPLET 409
            |  |::....|.|:.:..:.|.:..|....:....:..|...::..:..:.|:.|......|.:.
Zfish   246 PIIVSVSEEEELTVKDAVDAIVEGFGFKGEVIYDTSKSDGQIKKTANNGKLRRYLPDFKFTPFKE 310

  Fly   410 GLQRTISYF--RNELARS 425
            .::.|..:|  ..|.||:
Zfish   311 AVKETCDWFAANYETART 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 70/340 (21%)
UGD_SDR_e 116..419 CDD:187541 69/335 (21%)
gfus.2NP_001003528.1 GDP_FS_SDR_e 16..319 CDD:187550 68/332 (20%)
Epimerase 17..249 CDD:279681 57/261 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.