DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and F08F3.10

DIOPT Version :10

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_872219.2 Gene:F08F3.10 / 353440 WormBaseID:WBGene00017266 Length:208 Species:Caenorhabditis elegans


Alignment Length:38 Identity:12/38 - (31%)
Similarity:20/38 - (52%) Gaps:3/38 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKRLKIVAAISLLLLLLVYLYRMASFCPSGKVAVSVPG 42
            |..||::....|:|:|.:.|:.:|.   |..|..|:.|
 Worm   115 KSNLKLLKPQLLVLVLQIGLFVIAI---SSLVVYSMTG 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 UGD_SDR_e 116..419 CDD:187541
F08F3.10NP_872219.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.