powered by:
Protein Alignment Uxs and F08F3.10
DIOPT Version :9
Sequence 1: | NP_648182.1 |
Gene: | Uxs / 38911 |
FlyBaseID: | FBgn0035848 |
Length: | 441 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_872219.2 |
Gene: | F08F3.10 / 353440 |
WormBaseID: | WBGene00017266 |
Length: | 208 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 12/38 - (31%) |
Similarity: | 20/38 - (52%) |
Gaps: | 3/38 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 KKRLKIVAAISLLLLLLVYLYRMASFCPSGKVAVSVPG 42
|..||::....|:|:|.:.|:.:|. |..|..|:.|
Worm 115 KSNLKLLKPQLLVLVLQIGLFVIAI---SSLVVYSMTG 149
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Uxs | NP_648182.1 |
WcaG |
116..424 |
CDD:223528 |
|
UGD_SDR_e |
116..419 |
CDD:187541 |
|
F08F3.10 | NP_872219.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0451 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.