DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and Gmd

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_608888.2 Gene:Gmd / 33716 FlyBaseID:FBgn0031661 Length:395 Species:Drosophila melanogaster


Alignment Length:354 Identity:77/354 - (21%)
Similarity:132/354 - (37%) Gaps:92/354 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KRILITGGAGFVGSHLVDDLMVQGHEVI-VVDNFFTGRKRNVEHWL----GHENFEL-IHH---- 170
            |..||||..|..||:|.:.|:.:.:||. ::....|.....:||..    .|:...: :|:    
  Fly    47 KVALITGITGQDGSYLAEFLLKKDYEVHGIIRRASTFNTTRIEHLYADPKAHKGGRMKLHYGDMT 111

  Fly   171 ------DIVNPLFIEIDEIYHLASPASPPHYMYNPVK--------TIKTNTMGTINVL------G 215
                  .|:|  .::..|||:||:.:.        ||        |.:.:.:||:.:|      |
  Fly   112 DSSSLVKIIN--MVKPTEIYNLAAQSH--------VKVSFDLSEYTAEVDAVGTLRILDAIRTCG 166

  Fly   216 LAKRVMAKVLIASTSEVYGDPTVHPQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQV 280
            :.|.|  :...|||||:||.....||.|.     .|..||:.|...|.....:...|.:...:..
  Fly   167 MEKNV--RFYQASTSELYGKVVETPQNEQ-----TPFYPRSPYACAKMYGFWIVINYREAYNMYA 224

  Fly   281 RVARIFNTYGPRMHMNDGRVVSNFILQALRNETITVY---------GNGKQTRSFQYVSDLVDGM 336
            ....:||...||..       .||:.:.:......:|         ||....|.:.:.||.|:.|
  Fly   225 CNGILFNHESPRRG-------ENFVTRKITRSVAKIYHKQMEYFELGNLDSKRDWGHASDYVEAM 282

  Fly   337 IALMASNYTQPVNLGNPVEQTIGEFAEIIKKLV-----------------GGPSVIKQSKAMEDD 384
            ..::.........:......::.||.|...|.:                 .|..:::    :..:
  Fly   283 WMMLQRESPSDYVIATGETHSVREFVEAAFKHIDREITWKGKGVDEVGVENGTGIVR----VRIN 343

  Fly   385 PQRRKP--------DITRARQLLHWEPKV 405
            |:..:|        |.::|.:.|:|.|||
  Fly   344 PKYFRPTEVDLLQGDASKANRELNWTPKV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 77/354 (22%)
UGD_SDR_e 116..419 CDD:187541 77/354 (22%)
GmdNP_608888.2 NADB_Rossmann 47..389 CDD:304358 77/354 (22%)
GDP_Man_Dehyd 50..381 CDD:292973 76/351 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.