DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and hsd3b7

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_956103.1 Gene:hsd3b7 / 327462 ZFINID:ZDB-GENE-030131-5673 Length:368 Species:Danio rerio


Alignment Length:296 Identity:64/296 - (21%)
Similarity:103/296 - (34%) Gaps:68/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 NYKNRKRILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHWLGHENFE-----LIHH 170
            |.|::...:||||.||:|.||:..|:.:...|..:..|    .:||...|..|:.|     :|..
Zfish     4 NNKSKLTYVITGGCGFLGQHLLRVLLEKKKNVKEIRLF----DKNVFPSLQSESTEDVKVVIIQG 64

  Fly   171 DI-----VNPLFIEIDEIYHLASPASPPHYMYNPVKTI-KTNTMGTINVLGLAKRVMAKVLIAST 229
            ||     |...|:..|.::|.||.....:.:  |.|.| ..|..||.|.:.....:..:.|:   
Zfish    65 DITKYEDVRNAFLGADLVFHAASLVDVWYKI--PEKVIFAVNVQGTENAIKACVEIGIQYLV--- 124

  Fly   230 SEVYGDPTVHPQPETYWGHVNPIGPRACYDEGKRVSETLSY------AYAKQEKVQVRVARIFNT 288
                           |...:..:||....||..|.:|...|      .|.|.:....::.     
Zfish   125 ---------------YTSSMEVVGPNVKGDEFVRGNEDTPYNIFHEMPYPKSKAAAEKIV----- 169

  Fly   289 YGPRMHMNDGRVVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMIALMASNYTQPVNLGNP 353
                :..|..:|....||.........:||...|                ||...|...|..|..
Zfish   170 ----LEANGTKVEGGNILYTCCLRPTGIYGEQHQ----------------LMKDFYLNSVRNGGW 214

  Fly   354 VEQTIGEFAEIIKKLVGGPS--VIKQSKAMEDDPQR 387
            |.:.:....|..:...|..:  .:..::|:::.|.|
Zfish   215 VMRGVPPHTEHGRVYAGNVAWMHLLAARALQEHPNR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 62/291 (21%)
UGD_SDR_e 116..419 CDD:187541 62/291 (21%)
hsd3b7NP_956103.1 NADB_Rossmann 11..356 CDD:304358 62/289 (21%)
3Beta_HSD 12..286 CDD:279420 62/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.