DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and Gfus

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001120927.1 Gene:Gfus / 300036 RGDID:1307028 Length:321 Species:Rattus norvegicus


Alignment Length:326 Identity:78/326 - (23%)
Similarity:129/326 - (39%) Gaps:32/326 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHW--LGHENFELIHHDIVNPLF-- 177
            |||:|||:|.||..:         :.:|.|    |.....|.|  :..::.:|........||  
  Rat     9 RILVTGGSGLVGRAI---------QKVVAD----GAGLPGEEWVFVSSKDADLTDAAQTQALFQK 60

  Fly   178 IEIDEIYHLASPASP--PHYMYNPVKTIKTNTMGTINVLGLAKRVMAKVLIASTSE-VYGDPTVH 239
            ::...:.|||:....  .:..|| :...:.|.....|||..|..|..:.:::..|. ::.|.|.:
  Rat    61 VQPTHVIHLAAMVGGLFRNIKYN-LDFWRKNVHINDNVLHSAFEVGTRKVVSCLSTCIFPDKTTY 124

  Fly   240 PQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTYGP--RMHMNDGRVVS 302
            |..||...:..|......|...||:.:..:.||.:|...........|.:||  ..::.||.|:.
  Rat   125 PIDETMIHNGPPHSSNFGYSYAKRMIDVQNRAYFQQHGCTFTSVIPTNVFGPYDNFNIEDGHVLP 189

  Fly   303 NFI----LQALRNETITVYGNGKQTRSFQYVSDLVDGMI-ALMASNYTQPV--NLGNPVEQTIGE 360
            ..|    |.......:||:|.||..|.|.|..||....| .|...|..:|:  ::|...|.:|.|
  Rat   190 GLIHKVHLAKSSGSALTVWGTGKPRRQFIYSLDLARLFIWVLREYNEVEPIILSVGEEDEVSIKE 254

  Fly   361 FAEIIKKLVGGPSVIKQSKAMEDDPQRRKPDITRARQLLHWEPKVPLETGLQRTISYFRN--ELA 423
            .||.:.:.:.....:.......|...::.....:.|..|......|.:..::.|.::|..  |.|
  Rat   255 AAEAVVEAMDFSGEVTFDSTKSDGQYKKTASNGKLRSYLPDFCFTPFKQAVKETCAWFTENYEQA 319

  Fly   424 R 424
            |
  Rat   320 R 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 76/324 (23%)
UGD_SDR_e 116..419 CDD:187541 74/317 (23%)
GfusNP_001120927.1 GDP_FS_SDR_e 9..312 CDD:187550 74/316 (23%)
Epimerase 10..245 CDD:279681 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.