DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and MAT2B

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_037415.1 Gene:MAT2B / 27430 HGNCID:6905 Length:334 Species:Homo sapiens


Alignment Length:225 Identity:45/225 - (20%)
Similarity:80/225 - (35%) Gaps:53/225 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 REQKAELQRTRENLARLEEQVRSLQTSTPRKYPKVKYLNYKNRKRILITGGAGFVGSHLVDDLMV 137
            ||::..:.....:...:||:|                 |..|| |:|:||..|.:|..:      
Human     4 REKELSIHFVPGSCRLVEEEV-----------------NIPNR-RVLVTGATGLLGRAV------ 44

  Fly   138 QGHEVIVVDNFFT---GRKRNVEHWLGHENFELIH-------HDIVNPLFIEIDEIYHLASPASP 192
              |:....:|:..   |.:|      ....||.::       |.|::.....:  |.|.|:...|
Human    45 --HKEFQQNNWHAVGCGFRR------ARPKFEQVNLLDSNAVHHIIHDFQPHV--IVHCAAERRP 99

  Fly   193 PHYMYNPVKTIKTNTMGTINVLGLAKRVMAKVLIASTSEVYG--DPTVH----PQPETYWGHVNP 251
            ......|....:.|...:.|:...|..|.|.::..|:..|:.  :|...    |.|...:|....
Human   100 DVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKL 164

  Fly   252 IGPRACYDE--GKRVSETLSYAYAKQEKVQ 279
            .|.:|..:.  |..|.. :...|.:.||::
Human   165 DGEKAVLENNLGAAVLR-IPILYGEVEKLE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 37/182 (20%)
UGD_SDR_e 116..419 CDD:187541 37/182 (20%)
MAT2BNP_037415.1 dTDP_HR_like_SDR_e 30..316 CDD:187564 37/181 (20%)
Required for interaction with MAT2A. /evidence=ECO:0000269|PubMed:25075345 319..334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.