DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and Gfus

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_006520812.1 Gene:Gfus / 22122 MGIID:98857 Length:351 Species:Mus musculus


Alignment Length:373 Identity:74/373 - (19%)
Similarity:133/373 - (35%) Gaps:90/373 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHW--LGHENFELIHHDIVNPLF-- 177
            |||:|||:|.||..:         :.:|.|    |.....|.|  :..::.:|........||  
Mouse     9 RILVTGGSGLVGRAI---------QKVVAD----GAGLPGEEWVFVSSKDADLTDAAQTQALFQK 60

  Fly   178 IEIDEIYHLASPASP--PHYMYNPVKTIKTNTMGTINVLGLAKRVMAKVLIASTSE-VYGDPTVH 239
            ::...:.|||:....  .:..|| :...:.|.....|||..|..|.|:.:::..|. ::.|.|.:
Mouse    61 VQPTHVIHLAAMVGGLFRNIKYN-LDFWRKNVHINDNVLHSAFEVGARKVVSCLSTCIFPDKTTY 124

  Fly   240 PQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQE-KVQVRVARIF-------NTYGP----- 291
            |..||            ....|...|....|:|||:. .||.|...:.       ...||     
Mouse   125 PIDET------------MIHNGPPHSSNFGYSYAKRMIDVQNRCCLLVLPRPLWRGEDGPWEPTS 177

  Fly   292 -----------------RMHMNDGRVVSNFILQALR------------------NETITVYGNGK 321
                             .|..:..::.:.:...::|                  :..:||:|.||
Mouse   178 SSTAVPSPPSSLPMSLGLMTTSTSKMATCYPASSIRCTWPRVSAAIRHTPGPGSDSALTVWGTGK 242

  Fly   322 QTRSFQYVSDLVDGMI-ALMASNYTQPV--NLGNPVEQTIGEFAEIIKKLVGGPSVIKQSKAMED 383
            ..|.|.|..||....| .|...:..:|:  ::|...|.:|.|.||.:.:.:.....:.......|
Mouse   243 PRRQFIYSLDLARLFIWVLREYSEVEPIILSVGEEDEVSIKEAAEAVVEAMDFNGEVTFDSTKSD 307

  Fly   384 DPQRRKPDITRARQLLHWEPKVPLETGLQRTISYFRNELARSDRFQES 431
            ...::.....:.|..|......|.:..::.|.::|      :|.::::
Mouse   308 GQYKKTASNGKLRSYLPDFRFTPFKQAVKETCTWF------TDNYEQA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 73/364 (20%)
UGD_SDR_e 116..419 CDD:187541 72/359 (20%)
GfusXP_006520812.1 GDP_FS_SDR_e 9..342 CDD:187550 72/358 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.