DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and C32D5.12

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_495280.1 Gene:C32D5.12 / 174053 WormBaseID:WBGene00016319 Length:357 Species:Caenorhabditis elegans


Alignment Length:346 Identity:67/346 - (19%)
Similarity:113/346 - (32%) Gaps:94/346 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ILITGGAGFVGSHLVDDLM--VQGHEVIVVDNFFTGRKRNVEHWLGHENFELIHHDIVNPLFIE- 179
            :.:|||||.||.::|..|:  .|..|:.::|...|.|..:       ...:|...|:.:...:| 
 Worm     4 VAVTGGAGLVGRYVVQRLLENEQIAEIRIIDRQSTSRDES-------RKVKLYQIDLNDRKSLEN 61

  Fly   180 ----IDEIYHLASPASPPHYM-------------YNPVKTIKTNTMGTINVLGLAKRVMAKVLIA 227
                .|.:.|.|....|..|.             .|..::: .:||..:|:..|.....|...|.
 Worm    62 ALRGCDGVIHCAHSPFPIFYSKDKEQNNLMWRDNLNACESV-VDTMTNLNIKTLVNIGCAYCPIP 125

  Fly   228 S------TSEVYGDPTVHPQPETY----WGHVNPIGPRACYDEGKRVS-------ETLSYAYAKQ 275
            :      ..:|:.|     .|..|    :|.....|........|:.|       .|..|...|.
 Worm   126 NEDNYGLAQDVFLD-----YPRNYMLDEYGESRTRGEMYARKAAKKGSFNGIFLRPTFVYGLGKS 185

  Fly   276 EKVQVRVARIFNT-----YGPRMHMNDGRVVSNFILQALRNETITVYG----NGK---------- 321
            :|:......|.|:     .|.|..|:......|....|.::....:|.    ||:          
 Worm   186 KKIDTIKELILNSALPFVTGERRGMHQFIYAGNLAAIAEKSFFGLIYNSKRLNGEIVFCMDENCA 250

  Fly   322 -QTRSF--------QYVSDLVDGMIALMASNYTQ----------PVNLGNPV------EQTIGEF 361
             ..|.|        .|..::........|::|..          |.|:.|.|      |:|:|..
 Worm   251 HSIRDFFESRFLNPNYCQEVAVSYWPSFATSYLNYWKNMLGFKIPENILNHVAFRLFFEKTVGFP 315

  Fly   362 AEIIKKLVGGPSVIKQSKAME 382
            .:.::.|:.....|.|.:|.:
 Worm   316 NKKLRLLLNSKPEISQEEAFK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 67/346 (19%)
UGD_SDR_e 116..419 CDD:187541 67/346 (19%)
C32D5.12NP_495280.1 MupV_like_SDR_e 4..326 CDD:187573 64/334 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.