DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and ZC449.8

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001257016.1 Gene:ZC449.8 / 13220478 WormBaseID:WBGene00195189 Length:70 Species:Caenorhabditis elegans


Alignment Length:48 Identity:12/48 - (25%)
Similarity:20/48 - (41%) Gaps:10/48 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 RMHMNDGRVVSNF--ILQALRNETITVYGNGKQTRSFQYVSDLVDGMI 337
            ::|.....|::|.  ||:...|:.:        ..||...|.:|.|.|
 Worm    21 QLHKETEGVLTNVVSILKTQENQDV--------APSFTDQSTVVKGSI 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 12/48 (25%)
UGD_SDR_e 116..419 CDD:187541 12/48 (25%)
ZC449.8NP_001257016.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.