powered by:
Protein Alignment Uxs and ZC449.8
DIOPT Version :9
Sequence 1: | NP_648182.1 |
Gene: | Uxs / 38911 |
FlyBaseID: | FBgn0035848 |
Length: | 441 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257016.1 |
Gene: | ZC449.8 / 13220478 |
WormBaseID: | WBGene00195189 |
Length: | 70 |
Species: | Caenorhabditis elegans |
Alignment Length: | 48 |
Identity: | 12/48 - (25%) |
Similarity: | 20/48 - (41%) |
Gaps: | 10/48 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 292 RMHMNDGRVVSNF--ILQALRNETITVYGNGKQTRSFQYVSDLVDGMI 337
::|.....|::|. ||:...|:.: ..||...|.:|.|.|
Worm 21 QLHKETEGVLTNVVSILKTQENQDV--------APSFTDQSTVVKGSI 60
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Uxs | NP_648182.1 |
WcaG |
116..424 |
CDD:223528 |
12/48 (25%) |
UGD_SDR_e |
116..419 |
CDD:187541 |
12/48 (25%) |
ZC449.8 | NP_001257016.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0451 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.