DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and Hsd3b7

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_036008429.1 Gene:Hsd3b7 / 101502 MGIID:2141879 Length:372 Species:Mus musculus


Alignment Length:290 Identity:67/290 - (23%)
Similarity:102/290 - (35%) Gaps:89/290 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 TGGAGFVGSHLVDDLMVQG---HEVIVVDNFFTGRKRNVEHWL-----GHENFELIHHDIVNPLF 177
            :.|.||:|.|:|..|:.:.   .|:.|.|       .::..||     |......|..|:.    
Mouse    18 SSGCGFLGEHIVRMLLEREPRLRELRVFD-------LHLSSWLEELKAGPVQVTAIQGDVT---- 71

  Fly   178 IEIDEIYHLASPASPPHYMYNPV-----------KTI-KTNTMGTINVLGLAKRVMAKVLI-AST 229
                :.:.:|:..|..|.:.:..           ||| |.|..||.||:....:...:.|: .|:
Mouse    72 ----QAHEVAAAMSGSHVVIHTAGLVDVFGKASPKTIHKVNVQGTQNVIDACVQTGTQYLVYTSS 132

  Fly   230 SEVYGDPTVHPQP----------ETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVAR 284
            .||.| |.:...|          |....|     |..|           |.|.|:|..::.    
Mouse   133 MEVVG-PNIKGHPFYRGNEDTPYEAVHSH-----PYPC-----------SKALAEQLVLEA---- 176

  Fly   285 IFNTYGPRMHMNDGRVVSN---FILQALRNETITVYGNGKQT-RSFQYVSDLVDGMI--ALMASN 343
                        :||.|:.   .:..|||  ...:||.|.|. |.|.|......|.:  |:.||.
Mouse   177 ------------NGRKVNGGLPLVTCALR--PTGIYGEGHQVMRDFYYQGLRFGGRLFRAVPASV 227

  Fly   344 YTQPVNLGNPVEQTIGEFAEIIKK--LVGG 371
            ....|.:||.....|....|:.::  |:||
Mouse   228 EHGRVYVGNVAWMHILVARELEQRAALMGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 67/290 (23%)
UGD_SDR_e 116..419 CDD:187541 67/290 (23%)
Hsd3b7XP_036008429.1 3b-HSD_HSDB1_like_SDR_e 20..364 CDD:187671 67/288 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.