DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and sdr42e2

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_003198236.1 Gene:sdr42e2 / 100535848 ZFINID:ZDB-GENE-101203-3 Length:444 Species:Danio rerio


Alignment Length:273 Identity:61/273 - (22%)
Similarity:109/273 - (39%) Gaps:59/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHW-----LGHENFELIHHDIVNPL 176
            |:|:|||||:.|..|...|..||..|:::|       .:...|     ...:..::..:|.:..:
Zfish    71 RVLVTGGAGYFGYRLGRALARQGAAVVLLD-------LHQPPWDIPDGAVFQQIDIRDYDTLYKI 128

  Fly   177 FIEIDEIYHLAS--PASPPHYMYNPVKTIKTNTMGTINVLGL-AKRVMAKVLIASTSEVY----- 233
            ...:|.|:|.||  .:.|.......::::  |..||.||:.: |:|.:::::..||..|.     
Zfish   129 SAGVDVIFHTASYGMSGPEQLRKKQIESV--NVGGTNNVINVCAERGISRLIYTSTVNVAFAGRP 191

  Fly   234 ---GDPTVHP--QPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEK-----VQVRVARIFNT 288
               ||....|  ..:.:..|         |...|.::|.:..|..::..     :...|.|....
Zfish   192 IEDGDEDSVPCVPLDMHIDH---------YSRTKAIAERMVLAANRRSTKGGGLLHTCVLRPSGI 247

  Fly   289 YGP--RMHMNDGRVVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMI----------ALMA 341
            |||  |.|::  ||:.|    ..|......:|:.....::.:|.:||...:          |.:|
Zfish   248 YGPEERRHLH--RVMVN----VERRFFSFCFGDPNAKMNWVHVDNLVTAHVLAAQALTAEKAFVA 306

  Fly   342 SNYTQPVNLGNPV 354
            |.....:|.|..|
Zfish   307 SGQAYFINDGESV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 61/273 (22%)
UGD_SDR_e 116..419 CDD:187541 61/273 (22%)
sdr42e2XP_003198236.1 SDR 72..409 CDD:330230 60/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.