DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and ADGRG1

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_005256294.1 Gene:ADGRG1 / 9289 HGNCID:4512 Length:698 Species:Homo sapiens


Alignment Length:275 Identity:54/275 - (19%)
Similarity:106/275 - (38%) Gaps:70/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 IITMICFVLTIAVYLYI-------KKLRNVTGKCIVCCIVSRFIQCLIMILDHLNLLNGI---CS 281
            :::.:..::|||.||..       :|.|:.|.|..:..:::.|:.....:|.....|.|.   |.
Human   417 VVSALACLVTIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCR 481

  Fly   282 PAGYSSHFFRMASNLWLSVISYHTWKVLTSL-NRVDPNYRFLRYNAFVWSTAAIMTGSIYIVNQI 345
            .:....||..:....|:.:..|:.::::..: ....|.| .|:.:|..|.....:...:.:|:..
Human   482 ASAIFLHFSLLTCLSWMGLEGYNLYRLVVEVFGTYVPGY-LLKLSAMGWGFPIFLVTLVALVDVD 545

  Fly   346 WENDPSKWNWLPLV--------GFI---RCSVKDWHPSVWIYISGPSL--ALSTFNVAMFALTAI 397
                    |:.|::        |.|   .|.::|   |:..||:...|  .:..||:||.|...:
Human   546 --------NYGPIILAVHRTPEGVIYPSMCWIRD---SLVSYITNLGLFSLVFLFNMAMLATMVV 599

  Fly   398 YIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTW------------------IFN 444
            .|.:::....|:::               .|..|.||:|:||.|                  :|:
Human   600 QILRLRPHTQKWSH---------------VLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFS 649

  Fly   445 VI-PYSARLHIFWEW 458
            :| .:...|...|.|
Human   650 IITSFQGFLIFIWYW 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
ADGRG1XP_005256294.1 GPS 349..393 CDD:280071
7tm_4 408..659 CDD:304433 51/268 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.