DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and adgre5b.3

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_005160275.1 Gene:adgre5b.3 / 792970 ZFINID:ZDB-GENE-121214-275 Length:756 Species:Danio rerio


Alignment Length:264 Identity:47/264 - (17%)
Similarity:107/264 - (40%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LIITMICFVLTIAVYLYIKKLRNVTGKCIVCCIVSRFIQCLIMILDHLNLLNGI-CSPAGYSSHF 289
            |::::||.:|.|..:.:.:.::.......:...|..||..|:.:....:..|.: |:......||
Zfish   474 LVLSLICLILCILTFRFCRSIQGTRNSIHLHLSVCLFIADLVFLCGISSTHNQVACAIVAGLLHF 538

  Fly   290 FRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWSTAAIMTGSIYIVNQIWENDPSKWN 354
            |.:::..|:.:.....::::..:......:.:: |.........|::.|...|.:.:..|  :..
Zfish   539 FFLSAFCWMLLEGVQLYRMVVLVFHTTLKHLYM-YAVGYGVPLVIVSISAIAVPKGYGTD--RHC 600

  Fly   355 WLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKVKGGINKFT--NEEEGRI 417
            ||.|.|::..|         .:|  |...:...|:.:|.:|...:..      ||:  |.:..::
Zfish   601 WLSLEGYLILS---------FFI--PVCIIVILNITVFIITVWKLAL------KFSSLNPDLSKL 648

  Fly   418 NCINFDSQTYLQFLRLSI----VMGLTWIFNVIPY-----SARLHIFWEWVGIISEYFHSAFGIV 473
            :.|.       .||..::    |:|.:|:|....:     ...|::|     ||   .:|..|.:
Zfish   649 HKIR-------SFLATAVAQLCVLGGSWVFGFFLFQKNGTEVMLYLF-----II---LNSLQGAL 698

  Fly   474 LFVL 477
            :|::
Zfish   699 IFIM 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
adgre5b.3XP_005160275.1 EGF_CA 32..>62 CDD:214542
EGF_CA 72..105 CDD:214542
EGF_CA <121..152 CDD:214542
EGF_CA 154..188 CDD:214542
GPS 416..460 CDD:197639
7tm_2 466..699 CDD:278432 46/259 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.