DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and Adgrd1

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_001070157.3 Gene:Adgrd1 / 689257 RGDID:1594795 Length:903 Species:Rattus norvegicus


Alignment Length:320 Identity:54/320 - (16%)
Similarity:122/320 - (38%) Gaps:49/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 YCLYRHNFD---SDFPKSMWIIRHRCTSHISPGSLEILIITMICFVLTIAVYLYIKKLRN----V 249
            :|.:..||.   ...|..:.:......|.||.....:.::.:...::|.||...:..:||    :
  Rat   569 HCTHLTNFAILMQVVPLKLTLGHQVALSSISYVGCSLSVLCLAATLVTFAVLSSVSTIRNQRYHI 633

  Fly   250 TGKCIVCCIVSRFIQCLIMILDHLNLLNGI--CSPAGYSSHFFRMASNLWLSVISYHTWKVLTSL 312
            ........:|::     :::|...::..|.  |.......|:|.:.:..|:.|...|.:.::..:
  Rat   634 HANLSFAVLVAQ-----VLLLISFSMEPGTVPCQVLAVLLHYFFLTAFAWMLVEGLHLYSMVIKV 693

  Fly   313 NRVDPNYRFLRYNAFVWSTAAIMTGSIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYI 377
            ...:.: :.|.|....|. ..::...|.:.:.:.........||        ||:.  .::|.::
  Rat   694 FGSEDS-KHLYYYGIGWG-CPLLICIISVSSSMDSYGTGDSCWL--------SVES--GAIWAFV 746

  Fly   378 SGPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWI 442
             ||:|.:...|:.:.    :.:.:|...|:..:.:..|..:.....::.....|.   ::|.:|:
  Rat   747 -GPALLVIVVNIVIL----VAVTRVISHISTDSYKIHGDPSAFKLTAKAVAVLLP---ILGTSWV 803

  Fly   443 FNVIPYSARLHIFWEWVGIISEYFHSAFGIVLFVLLVL-----------KRSTWTLMMDS 491
            |.|:..|.|..:|.....|:    :|:.|:.:|:...|           |...|:|...|
  Rat   804 FGVLAVSDRALVFQYMFAIL----NSSQGLFIFLFHCLLNSEVRAAFKHKMKVWSLTSSS 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 4/24 (17%)
Adgrd1XP_001070157.3 LamG <173..273 CDD:304605
GPS 539..579 CDD:280071 3/9 (33%)
7tm_4 595..831 CDD:304433 44/264 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.