DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and Adgrl4

DIOPT Version :10

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_071630.1 Gene:Adgrl4 / 64124 RGDID:621136 Length:738 Species:Rattus norvegicus


Alignment Length:304 Identity:61/304 - (20%)
Similarity:121/304 - (39%) Gaps:70/304 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 RCTSHI-------SPG-SLEI-------------LIITMICFVLTIAVYLYIKKLRNVTGKCI-- 254
            || ||:       ||. |:|:             :||::||..:.|..:.:..:::: |...|  
  Rat   450 RC-SHLTHFAILMSPSTSI
EVKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQS-TRTTIHK 512

  Fly   255 -VCCIVSRFIQCLIMILD-HLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDP 317
             :||  |.|:..|:.::. ::|....:||......|:|.:|:..|:.:...:.:.::..|..   
  Rat   513 NLCC--SLFLAQLVFLVGININTNKLVCSIIAGLLHYFFLAAFAWMCIEGIYLYLIVVGLIY--- 572

  Fly   318 NYRFLRYNAFVWS--TAAIMTG-------SIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSV 373
            |..||..|.:::.  :.|::.|       ..|...::                  |.:...:..:
  Rat   573 NKGFLHKNFYIFGYLSPAVVVGFSASLGYRYYGTTKV------------------CWLSTENNFI 619

  Fly   374 WIYISGPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMG 438
            |.:| ||:..:...|:..|.:....:.:...|:       :..::|...........|.|..::|
  Rat   620 WSFI-GPACLIILVNLLAFGVIIYKVFRHTAGL-------KPEVSCYENIRSCARGALALLFLLG 676

  Fly   439 LTWIFNVIPYSARLHIFWEWVGIISEYFHSAFGIVLFVLLVLKR 482
            .||.|.|: :.....:...::..:|..|...| |.|| |.||.|
  Rat   677 TTWTFGVL-HVVHASVVTAYLFTVSNAFQGMF-IFLF-LCVLSR 717

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity