DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and adgrg11

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_017208200.1 Gene:adgrg11 / 563883 ZFINID:ZDB-GENE-041210-320 Length:793 Species:Danio rerio


Alignment Length:322 Identity:62/322 - (19%)
Similarity:122/322 - (37%) Gaps:78/322 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 CGLIVWFQDGKFWVTVDLFMEKQDYCLYRHNFDSDFPKSMWIIRHRCTSHISPGSLEILI-ITMI 231
            |||      ..|::.|.|||    :.|.|              :.:.|:     |:.:|| :.:.
Zfish   522 CGL------SMFFLGVGLFM----HFLMR--------------KAKATN-----SVHVLINLFLA 557

  Fly   232 CFVLTIAVYL--YIKKLRNVTGKCIVCCIVSRFIQCLIMILDHLNLLNGICSPAGYSSHFFRMAS 294
            .|:|.:|...  |:.:.:|    .|:|.:::.|:                        |:..::|
Zfish   558 LFMLNVAFLTNEYVVQAQN----SILCRVMAAFL------------------------HYCLLSS 594

  Fly   295 NLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWSTAAIMTGSIYIVNQIWENDPSKWNWLPLV 359
            ..|.:|.:.|....:|....:  .:..|:.....|:..|.:...|:.:.:..|::....:....:
Zfish   595 FTWFAVEALHLCLQMTKTATL--KHYLLKITVAGWAPPAFVVSVIFSLGKYGEDNIMTESRNVTM 657

  Fly   360 GFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDS 424
            .:|..|...:..::..|....:..|.||.|.:..|:.:.:.|.         .::|::......:
Zfish   658 CWIVDSTVHYVVNIGYYCFVFTFTLGTFIVVVRWLSMLRMSKW---------SKDGKVKRSGTAT 713

  Fly   425 QTYLQFLRLSIVMGLTWIFNVIPYSA-RLHIFWEWVGIISEYFHSAFGIVLFVLLVLKRSTW 485
            ......|.|..::||||..:...|.| |:..::     |....:|..|..||| ..||.||:
Zfish   714 SDISTMLGLCCLLGLTWGISFFSYGALRMPSYY-----IFTILNSLQGFFLFV-YYLKTSTF 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 10/45 (22%)
adgrg11XP_017208200.1 GPS 457..498 CDD:280071
7tm_4 511..759 CDD:304433 55/309 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.