DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and Adgre4

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_631877.2 Gene:Adgre4 / 52614 MGIID:1196464 Length:689 Species:Mus musculus


Alignment Length:282 Identity:61/282 - (21%)
Similarity:107/282 - (37%) Gaps:72/282 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LIITMICFVLTIAVYLYIKKLRNVTGKCIVCCIVSRFIQCLI-MILDHLNLLNGI--------CS 281
            |.::::|..|....:|..:.::|.:        .:..:|..| :.|..|..|.||        ||
Mouse   354 LSLSLLCLFLAAITFLLCRPIQNTS--------TTLHLQLSICLFLADLLFLTGINRTKPKVLCS 410

  Fly   282 PAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNY--------RFL---RYN--AFVWSTAA 333
            ......|:..:||.:|:.:...|.:  ||..|....||        ||:   .|.  ||:.:.:|
Mouse   411 IIAGMLHYLYLASFMWMFLEGLHLF--LTVSNLKVANYSNSGRFKKRFMYPVGYGLPAFIVAVSA 473

  Fly   334 IMTGSIYIVNQIWENDPSKWNWLPL-VGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAI 397
            |.....|        ......||.| .|||           |.:: ||:.|:...|:..:.|...
Mouse   474 IAGHKNY--------GTHNHCWLSLHRGFI-----------WSFL-GPAAAIILINLVFYFLIIW 518

  Fly   398 YIRKVKGGINK-FTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWIFNVIPYSARLHIFWE---W 458
            .:|.....:|| .:..::.::       .|:...::| .|:|.:|       ...|.||.|   .
Mouse   519 ILRSKLSSLNKEVSTLQDTKV-------MTFKAIVQL-FVLGCSW-------GIGLFIFIEVGKT 568

  Fly   459 VGIISEYFHSAFGIVLFVLLVL 480
            |.:|..|..:...::..||:.:
Mouse   569 VRLIVAYLFTIINVLQGVLIFM 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
Adgre4NP_631877.2 EGF_CA 77..>105 CDD:214542
GAIN <214..262 CDD:293098
GPS 290..332 CDD:280071
7tm_4 343..588 CDD:304433 60/278 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.