DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and CG15556

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster


Alignment Length:326 Identity:58/326 - (17%)
Similarity:105/326 - (32%) Gaps:117/326 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LEILIITMICFVLTIAVYLYIKKLRNVTGKCIVCCIVSRFIQCL-IMILDHLNLLNGI------- 279
            |.:.::.::...:|.||:...:.|.:......:|..:.  :|.| .:||...:||..:       
  Fly   469 LTLSLLGLLMIFITAAVFKSFRTLASTKILLNLCAALG--LQLLFFLILSQSHLLEQLEQSESER 531

  Fly   280 CSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWSTAAIMTGSIYIVNQ 344
            |:..|....:..:....|:.:|.                  ||:|..:              |..
  Fly   532 CTLVGAVMQYLLLVVFSWMFIIG------------------FLQYQRY--------------VRV 564

  Fly   345 IWENDP---------SKWNWLPLV----------GFIRCSVKDWHPSVWIYISGPSLALSTFNVA 390
            |..|.|         :.|. |||:          |..|.:.......:..|.||..|:|.     
  Fly   565 IGVNHPRHYILMSAVAAWT-LPLIPTLLVVFLEPGSYRPNNSSMDYPILCYPSGYGLSLG----- 623

  Fly   391 MFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYL-----------QFLRLSIVMGLTWIFN 444
              .:..|.:..|...|         .:..|::...|.|           .|:.|..::|:||||.
  Fly   624 --VILPIGLITVANAI---------LVGYISWSVYTALFKRDLIFKQLGLFVLLFFLLGITWIFG 677

  Fly   445 VIPYSARLHIFWEWVGIISEYF---HSAFGIVLFVLLVL------------------KRSTWTLM 488
            :..|       :::..|.:..|   .:..|.|||:..::                  ||:..|:.
  Fly   678 LCTY-------FDFGRIFAYLFCLTATLQGFVLFLYFIVFNKENQRAWLGLCCNSSKKRNQQTIQ 735

  Fly   489 M 489
            |
  Fly   736 M 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 50/279 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462187
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.