DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and CG11318

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster


Alignment Length:381 Identity:63/381 - (16%)
Similarity:136/381 - (35%) Gaps:109/381 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 IIRDEFFDCDEMIYISDFNYFL----------EEVSIQIFNK----------CGLIVWFQDGKFW 180
            :::|...:| ...:::.|.:.:          ||:.|...|:          |.|.:....|.| 
  Fly   458 LLKDAIIEC-HTNHLTQFAFLVGGSYRANDLGEEILITPINEKVLDIISIVGCSLSLLGILGIF- 520

  Fly   181 VTVDLFMEKQDYCLYRHNFDSDFPKSMWIIRHRCTSHISPGSLEILIITMICFVLTIAVYLY--- 242
            :|..||...:...            |..::.|.|.:              :|..:.:.|:|.   
  Fly   521 LTAALFKSWRSQA------------STKVLLHLCLA--------------MCLQMMLFVFLNTDD 559

  Fly   243 IKKLRNVTGKCIVCCIVSRFIQCLIMILDHLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWK 307
            :.:...|.|..:.|..:...:|..|::|              :|          |:.:|::..::
  Fly   560 VSEALVVNGNTVRCVALGAAMQYSILVL--------------FS----------WMLIIAFLQFQ 600

  Fly   308 VLTSLNRVDPNYRFLRYNAFV-WSTAAIMTGSIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHP 371
            ...::..::...|::...|.| |....:.|..:.::      ||.  :::|....:.......:|
  Fly   601 RYVTVIGIERPPRYILKAAIVAWLLPLVPTLLVALI------DPD--SYVPSAAQLSTDTGICYP 657

  Fly   372 SVWIYISGPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSI- 435
            |.:..|.|..|.::...|....:.......:...:::..::.|.::         .::.:|||| 
  Fly   658 SGYGLIFGVVLPVTLITVCNLVIFVYVFYSISHSLSQSIHKNEKKM---------VVKQIRLSIM 713

  Fly   436 ---VMGLTWIFNVIPYSARLHIFWEWVGIISEYFH----SAFGIVLFVLLVLKRST 484
               ::||||||.:..:..        .|:...|..    :..|.|:|:..||..||
  Fly   714 LFFLLGLTWIFGIFAFMQ--------AGVAFSYLFCITATMQGFVMFIYFVLLDST 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 16/97 (16%)
CG11318NP_651842.3 GPS 437..475 CDD:280071 2/17 (12%)
7tm_4 500..750 CDD:304433 50/325 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.