DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and adgrl4

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_998532.2 Gene:adgrl4 / 406676 ZFINID:ZDB-GENE-040426-2689 Length:735 Species:Danio rerio


Alignment Length:275 Identity:62/275 - (22%)
Similarity:116/275 - (42%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LIITMICFVLTIAVYLYIKKLRNVTGKCI---VCCIVSRFI-QCLIMILDHLNLLNGICSPAGYS 286
            ::|::||..:.|..:.:.:.::| |...|   :||  |.|: |.:.:|..:.:.....||.....
Zfish   480 MVISLICLSMCIFTFWFFRDIQN-TRTTIHKNLCC--SLFMAQFIFLIGINKSAHKWFCSLIAGL 541

  Fly   287 SHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYN--AFVWSTAAIMTGSIYIVNQIWEND 349
            .|:|.:|:..|:.:...|.:.::..   |..|..||..|  ||.:.:.|::......:...:...
Zfish   542 LHYFFLAAFAWMCIEGIHLYLIVVG---VIYNKGFLHRNFYAFGYGSPAVVVAISATLGYKYYGT 603

  Fly   350 PSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKV-------KGGIN 407
            .|.           |.:...:..:|.:| ||::.:...|:..|   |:.|.||       |..|:
Zfish   604 SSV-----------CWLSTENNFIWSFI-GPAILIILVNLLAF---AVIIYKVYRHTAVKKPEIS 653

  Fly   408 KFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWIFNVIPYSARLHIFWEWVGIISEY---FHSA 469
            .:.|..    :|..       ..:.|..|:|:||.|.|      ::|.:|..  ::.|   |.:.
Zfish   654 HYENIR----SCAR-------GAIALLFVLGVTWAFGV------MYILYETT--LTAYLFTFANV 699

  Fly   470 F-GIVLFVLL-VLKR 482
            | |:.:|:.| ||.|
Zfish   700 FQGMFIFIFLCVLSR 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
adgrl4NP_998532.2 EGF_CA 34..56 CDD:304395
EGF_CA 60..93 CDD:238011
EGF_CA 110..143 CDD:214542
GAIN 188..386 CDD:293098
GPS 416..457 CDD:280071
7tm_4 469..705 CDD:304433 57/264 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.