DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and mthl8

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster


Alignment Length:533 Identity:97/533 - (18%)
Similarity:177/533 - (33%) Gaps:182/533 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FCTVLLLIFTNNSNAD--------IPGCNYYDTVDISYIERQNDSYLYDDIEIPASLTGYYEFRQ 64
            ||.:.:|:..:.::..        .| |.:.||.:|:.....:..::::...||......|:| .
  Fly     4 FCILGVLLILSGTHCSWGFHEETHYP-CAFIDTANITGSYGLDGPFVHNWTVIPRHFVAVYDF-V 66

  Fly    65 FGDGSITPIEKHLRACVCSVRPCIRICCPAKNFLANGKCDDGLKEELARFKPYIYFTYMDLQAR- 128
            ..:|...|..:|||||||..:||:||||              |:.|       ||    ||:.| 
  Fly    67 IENGIRIPASRHLRACVCKTKPCVRICC--------------LRGE-------IY----DLEKRQ 106

  Fly   129 --VPLTDMAIIRDEFFDCDEMIYISDFNYFLEEVSIQIFNKCGLIVWFQDGKFWVTVDLFMEKQD 191
              ||:..::.:...                 ..:.:::.|....:|..|. :|.:.|:...|...
  Fly   107 CLVPVAGVSSLPSH-----------------SHMEVELGNGSLRLVKLQP-RFSIHVETPCEHMK 153

  Fly   192 YCL----YRHNFDSDFPKSMWII--------------RHRCTSHISPGSLE-------------- 224
            ...    |.|          |.:              :|.|.:.:..|:..              
  Fly   154 AVTKGSEYVH----------WTLHENGTISHRGHIFSKHYCFTPLLHGNSTWEWQPLACAPEKLY 208

  Fly   225 ------------ILIITMICFVLTIAVYLYIKKLRN----VTGKCIVCCIVSRFIQCLIMILDHL 273
                        .|:|.::...:.:.|||...::||    |..|....|::..:     .:|.:|
  Fly   209 FVLGVREWTYAICLLIAILSMFIVLMVYLMCSEMRNSFYGVAIKAYAICMILGY-----ALLAYL 268

  Fly   274 NLLNGICSPAGYSSHFFRMASNLWLS--VISYHT----------------------WKVLTSLNR 314
            .|.|    ||..|:...|:..:|.|.  |:|::.                      |.:.|.:..
  Fly   269 TLHN----PANLSNAACRILPSLALMNLVLSFYILSFIAFKLYLSFYGVVFTKLMFWLIFTPIVL 329

  Fly   315 VDPNYRFLRYNAFVWSTAAIMTGSIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISG 379
            |...:.|  :..|.:..:.::.|.    :..| .||..|                  ||.||...
  Fly   330 VAVGWSF--FVGFSYYGSRLIFGG----DTCW-FDPRNW------------------SVMIYFYA 369

  Fly   380 PSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWIFN 444
            |.......:...:.|:.||||      ::...|.|.....|  :...:..|.:......:.|:..
  Fly   370 PVFVACAISGFFYVLSQIYIR------DQPDIETEKSFESI--EKNRFKSFWKYFGYTAVVWVVC 426

  Fly   445 VIPYSARLHIFWE 457
            :..::  .:.:||
  Fly   427 ICSFA--FNYYWE 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 42/207 (20%)
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 44/225 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 1 1.000 - - FOG0003851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.