DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and Dh44-R1

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster


Alignment Length:397 Identity:76/397 - (19%)
Similarity:143/397 - (36%) Gaps:119/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NYYDTVDIS----YIERQNDSYLYDDIEIPASLTGYYEFRQFGDGS---ITPIEKHLRACVCSVR 85
            |:.|:|:.|    .::..|...:.:.:|:...:..:.|...:|:.|   :|..:..|        
  Fly     5 NHIDSVNASGSDPLLDLHNLDGIGESVELQCLVQEHIEASTYGNDSGHCLTQFDSIL-------- 61

  Fly    86 PCIRICCP--AKNFLANGKCDDGLK-------EELARF----KPYIYFTYMDLQARVPLTDMAII 137
                 |.|  |:..||..:|.|.|:       :...||    ..:..:|..|..|.:|..:....
  Fly    62 -----CWPRTARGTLAVLQCMDELQGIHYDSSKNATRFCHANGTWEKYTNYDACAHLPAPESVPE 121

  Fly   138 RDEFFDCDEMIYISDFNYFLEEVSIQIFNKCGLIV--WFQDGKFWVTVDLFMEKQDYCLYRHNFD 200
            .:...:...:||.  ..|.|..||:.:    .|||  :|              |:..||      
  Fly   122 FEVIVELPTIIYY--IGYTLSLVSLSL----ALIVFAYF--------------KELRCL------ 160

  Fly   201 SDFPKSMWIIRHRCTSHISPGSLEILIITMICFVLTIAVYLYIKKLRNVTGKCIVCCIVSRFIQC 265
                        |.|.|.:  .....|::.:.::|.::|.:   .:|:..|.||  .:::.|   
  Fly   161 ------------RNTIHAN--LFFTYIMSALFWILLLSVQI---SIRSGVGSCI--ALITLF--- 203

  Fly   266 LIMILDHLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWS 330
                                  |||.:.:..|:.|...:.:.::......| |.||..|.:..|.
  Fly   204 ----------------------HFFTLTNFFWMLVEGLYLYMLVVKTFSGD-NLRFNIYASIGWG 245

  Fly   331 TAA--IMTGSIYIVNQIWENDPSKWNWLPLVGFIRCS-VKDWHPSVWIYISGPSLALSTFNVAMF 392
            ..|  ::|.::.....:..:.|.|:.       |.|. :::.|.. ||| .||..|:...|:. |
  Fly   246 GPALFVVTWAVAKSLTVTYSTPEKYE-------INCPWMQETHVD-WIY-QGPVCAVLIINLT-F 300

  Fly   393 ALTAIYI 399
            .|..:::
  Fly   301 LLRIMWV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 38/207 (18%)
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086 14/72 (19%)
7tmB1_DH_R 126..394 CDD:320391 51/263 (19%)
TM helix 1 129..153 CDD:320391 9/29 (31%)
TM helix 2 162..183 CDD:320391 4/22 (18%)
TM helix 3 197..219 CDD:320391 7/48 (15%)
TM helix 4 238..254 CDD:320391 3/15 (20%)
TM helix 5 279..302 CDD:320391 9/25 (36%)
TM helix 6 327..349 CDD:320391
TM helix 7 356..381 CDD:320391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462234
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.