DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and Dh44-R2

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster


Alignment Length:241 Identity:47/241 - (19%)
Similarity:87/241 - (36%) Gaps:59/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 FPKSMWIIRH-----RCTSHISPGSLEIL------------------IITMICFVLTIAVYLYIK 244
            ||...|  .|     ||  |.:.||:.::                  .::....|:.:.::|..|
  Fly   127 FPNGTW--DHYSDYDRC--HQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVALIIFLSFK 187

  Fly   245 KLRNVTGKCIVCCIVSRFIQCLIMILD-HLNLLNGICSPAGYSS-----HFFRMASNLWLSVISY 303
            .||.:.........::.....|:.||. .|.::....|.||..:     .:|.:.:..|:.|...
  Fly   188 DLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGL 252

  Fly   304 HTWKVLTSLNRVDPNYRFLRYNAFVWSTAAIMTGSIYIVNQIW----------ENDPSKWNWLPL 358
            :.:.::......| |..|:.|....|...|:..       .:|          ||:  .:|.|. 
  Fly   253 YLYTLVVQTFSSD-NISFIIYALIGWGCPAVCI-------LVWSIAKAFAPHLENE--HFNGLE- 306

  Fly   359 VGFIRCS-VKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKVK 403
               |.|: :::.|.. ||:....||||....|.:..:..:.|.|::
  Fly   307 ---IDCAWMRESHID-WIFKVPASLALLVNLVFLIRIMWVLITKLR 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 4/15 (27%)
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888 7/20 (35%)
7tm_2 159..407 CDD:278432 38/205 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.