DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and adgrg1

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001018317.1 Gene:adgrg1 / 324948 ZFINID:ZDB-GENE-030131-3671 Length:648 Species:Danio rerio


Alignment Length:333 Identity:59/333 - (17%)
Similarity:122/333 - (36%) Gaps:80/333 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 WFQDGKFWVTVDLFMEKQDYCLYRHNFDSDFPKSMWIIRHRCTSHISPGSLEILIITMICFVLTI 237
            |..||...|.::   |:|..|...|.  :.|...:.:.:.....|:...:....:...:..|..:
Zfish   326 WKDDGCDTVKIN---EEQTECHCNHL--TYFAILVQVEQKSTVRHLKALTFITAVGCAVSLVSCL 385

  Fly   238 AVYLYIKKLRNVTGKCIVCCIVSR------FIQCLIMILDHL--NLLN-GICSPAGYSSHFFRMA 293
            .::.::.|.|.  ||.....:|.|      |:.||..||..:  |:.| .:|...|...|:..::
Zfish   386 VLFYWLCKRRR--GKKNQISLVHRGLVVAIFLLCLFFILTGILANVANETVCQLTGSLLHYGLLS 448

  Fly   294 SNLWLSVISYHTWKVLTSL-NRVDPNYRFLRYN---AFVWSTAAIMTGSIYIVNQIWENDPSKWN 354
            :..|:::..:||:.::..: |...|.:.|....   .|:..:..:..|.||...:|..:|     
Zfish   449 TLCWMAMEVFHTFLLVRKVFNSPLPIWIFYLMGFGFPFLLVSILLSVGDIYGERKIKPSD----- 508

  Fly   355 WLPLVGFIRCSVKDWHPSVWIYISGPS-LALSTFNVAMFALTA--------IYIRKVKGGINKFT 410
                      .|.:.:...|:.....| ||....|:.:.|:..        :.:|:::       
Zfish   509 ----------DVNNPYRMCWMTEGDKSQLAHYIINIGLLAVVVSSGLVMLFLVVREIR------- 556

  Fly   411 NEEEGRINCINFDSQTYLQFLR---LSIVMGLTWIFNVIPYSARLHIFWEWVGIISEYFHSAFGI 472
            |..:.:        :.::.||.   |:.:.|.||....:.:           |..||       :
Zfish   557 NRPDWK--------KIHVAFLSIWGLTCLYGTTWALGFLDF-----------GPFSE-------V 595

  Fly   473 VLFVLLVL 480
            .||:..::
Zfish   596 TLFLFCII 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 9/40 (23%)
adgrg1NP_001018317.1 GPS 312..354 CDD:280071 9/32 (28%)
7tm_4 369..611 CDD:304433 49/285 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.