DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and Adgrl3

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_011247763.1 Gene:Adgrl3 / 319387 MGIID:2441950 Length:1586 Species:Mus musculus


Alignment Length:276 Identity:56/276 - (20%)
Similarity:110/276 - (39%) Gaps:64/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LIITMICFVLTIAVYLYIKKL---RNVTGKCIVCCIVSRFIQCLIMILDHLNLLNGI-------- 279
            ::::::|.::.|..:.:.:.|   ||...|.:          |:.:.:..|..|.||        
Mouse   953 ILLSLVCLLICIFTFCFFRGLQSDRNTIHKNL----------CISLFVAELLFLIGINRTDQPIA 1007

  Fly   280 CSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWSTAAIMTGSIYIVNQ 344
            |:......|||.:|:..|:.:.....:.:|..:...:.:.|...|.......|.|:..|..:..:
Mouse  1008 CAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPALIVAVSAAVDYR 1072

  Fly   345 IWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNV--------AMFALTAIYIRK 401
            .:..|  |..||.|..:.          :|.:| ||:..:...||        .||..|||    
Mouse  1073 SYGTD--KVCWLRLDTYF----------IWSFI-GPATLIIMLNVIFLGIALYKMFHHTAI---- 1120

  Fly   402 VKGGINKFTNEEEGRINCINF-DSQTYLQ-----FLRLSIVMGLTWIFNVIPYSARLHIFWEWVG 460
                    ...|.|.::.||: |::.:::     .:.|..::||||.|.:: |.....:...::.
Mouse  1121 --------LKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLM-YINESTVIMAYLF 1176

  Fly   461 IISEYFHSAFGIVLFV 476
            .|   |:|..|:.:|:
Mouse  1177 TI---FNSLQGMFIFI 1189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
Adgrl3XP_011247763.1 Gal_Lectin 111..191 CDD:366935
OLF 205..461 CDD:128580
HormR 563..627 CDD:214468
GAIN 636..856 CDD:374574
GPS 882..934 CDD:197639
7tmB2_Latrophilin-3 942..1208 CDD:320671 56/276 (20%)
TM helix 1 945..969 CDD:320671 2/15 (13%)
TM helix 2 978..999 CDD:320671 5/30 (17%)
TM helix 3 1009..1031 CDD:320671 5/21 (24%)
TM helix 4 1050..1066 CDD:320671 3/15 (20%)
TM helix 5 1085..1108 CDD:320671 6/33 (18%)
TM helix 6 1141..1166 CDD:320671 7/25 (28%)
TM helix 7 1170..1195 CDD:320671 5/23 (22%)
Latrophilin 1208..1586 CDD:367050
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.