DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and ADGRD1

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001317426.1 Gene:ADGRD1 / 283383 HGNCID:19893 Length:906 Species:Homo sapiens


Alignment Length:299 Identity:53/299 - (17%)
Similarity:110/299 - (36%) Gaps:58/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 SHISPGSLEILIITMICFVLTIAVYLYIKKLRN----VTGKCIVCCIVSRFIQCLIMILDHLNLL 276
            |.||.....:.::.::..::|.||...:..:||    :........:|:   |.|::|...|...
Human   599 SSISYVGCSLSVLCLVATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVA---QVLLLISFRLEPG 660

  Fly   277 NGICSPAGYSSHFFRMASNLWLSVISYHTWK-VLTSLNRVDPNYRFLRYNAFVWSTAAIMTGSIY 340
            ...|.......|:|.:::..|:.|...|.:. |:......|..:|:  |....|....:    |.
Human   661 TTPCQVMAVLLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDSKHRY--YYGMGWGFPLL----IC 719

  Fly   341 IVNQIWEND---PSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKV 402
            |::..:..|   .|...||.|..          .::|.::: |:|.:...|:.:.    |.:.:|
Human   720 IISLSFAMDSYGTSNNCWLSLAS----------GAIWAFVA-PALFVIVVNIGIL----IAVTRV 769

  Fly   403 KGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWIFNVIPYSARLHIFWEWVGIISEY-- 465
            ...|:....:..|..:.....::.....|.   ::|.:|:|.|:..:.        ..::.:|  
Human   770 ISQISADNYKIHGDPSAFKLTAKAVAVLLP---ILGTSWVFGVLAVNG--------CAVVFQYMF 823

  Fly   466 --FHSAFGIVLFVLLVL-----------KRSTWTLMMDS 491
              .:|..|:.:|:...|           |...|:|...|
Human   824 ATLNSLQGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSS 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
ADGRD1NP_001317426.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.