DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and ADGRF1

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_722582.2 Gene:ADGRF1 / 266977 HGNCID:18990 Length:910 Species:Homo sapiens


Alignment Length:370 Identity:76/370 - (20%)
Similarity:142/370 - (38%) Gaps:89/370 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 NYFLEEVSIQIFNK---------CGLIVWFQDGKFW--VTVDLFMEKQD----YCLYRHNF---- 199
            ||.:.||.: .|:|         |  :.|......|  ....|..|.||    .|.:..:|    
Human   512 NYSINEVFL-FFSKIESNLSQPHC--VFWDFSHLQWNDAGCHLVNETQDIVTCQCTHLTSFSILM 573

  Fly   200 -----DSDFPKSMWIIRHRCTSHISPGSLEILIITMICFVLTIAVYLYIKKLRNVTGKCIVCCIV 259
                 .:.||...||.  .....||.|||      ::|.::....:..|||.:....:.|  |:|
Human   574 SPFVPSTIFPVVKWIT--YVGLGISIGSL------ILCLIIEALFWKQIKKSQTSHTRRI--CMV 628

  Fly   260 SRFIQCLI--------MILDHLNLLNGICSPAGYSSHFFRMASNLWLSVIS-YHTWKVLTSLNRV 315
            :..:..||        ..:|.....:|:|:.|.:.:|||.::...|:.::. ...::::...:.:
Human   629 NIALSLLIADVWFIVGATVDTTVNPSGVCTAAVFFTHFFYLSLFFWMLMLGILLAYRIILVFHHM 693

  Fly   316 DPNYRF-----LRYNAFVWSTAAIMTGSIYIVNQIWENDPSKW-NW----LPLVGFIRCSVKDWH 370
            ..:...     |.|...:  ..:::|.::...:..::.....| ||    .||:.|:        
Human   694 AQHLMMAVGFCLGYGCPL--IISVITIAVTQPSNTYKRKDVCWLNWSNGSKPLLAFV-------- 748

  Fly   371 PSVWIYISGPSLALSTFN--VAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRL 433
                    .|:||:...|  |.:..||.:: |...|  .:.:.:::..|..:.      ...|.|
Human   749 --------VPALAIVAVNFVVVLLVLTKLW-RPTVG--ERLSRDDKATIIRVG------KSLLIL 796

  Fly   434 SIVMGLTWIFNV--IPYSARL--HIFWEWVGIISEYFHSAFGIVL 474
            :.::||||.|.:  |..|..|  |:.:..:.....:|...|||:|
Human   797 TPLLGLTWGFGIGTIVDSQNLAWHVIFALLNAFQGFFILCFGILL 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 19/83 (23%)
ADGRF1NP_722582.2 SEA 154..>215 CDD:279699
GPS 532..572 CDD:280071 9/41 (22%)
7tm_4 582..834 CDD:304433 56/288 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.