DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and Adgrg2

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_852031.1 Gene:Adgrg2 / 266735 RGDID:628618 Length:1013 Species:Rattus norvegicus


Alignment Length:313 Identity:57/313 - (18%)
Similarity:118/313 - (37%) Gaps:86/313 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 CT-SHIS-------------PGSLEILIITMICFV----------LTIAVYLYIKKL-RNVTGKC 253
            || ||::             |.| :::.:|.|.::          :|:..|:..:|: |:...|.
  Rat   597 CTCSHLTSFGILLDLSRTSLPPS-QMMALTFITYIGCGLSSIFLSVTLVTYIAFEKIRRDYPSKI 660

  Fly   254 IVCCIVSRFIQCLIMILDH-LNLLN--GICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRV 315
            ::....:..:..|:.:||. :.|.|  |.|.......|:|.:.|..|:.:.::|.:..|..:...
  Rat   661 LIQLCAALLLLNLVFLLDSWIALYNARGFCISVAVFLHYFLLVSFTWMGLEAFHMYLALVKVFNT 725

  Fly   316 DPNYRFLRYNAFVWSTAAIMTGSIYIVN----------QIWENDPSKWNWLPLVGFIRCSVKDWH 370
            ......|::....|...|::...:..::          :.....|..:.|:             :
  Rat   726 YIRKYILKFCIVGWGIPAVVVSIVLTISPDNYGIGSYGKFPNGTPDDFCWI-------------N 777

  Fly   371 PSVWIYIS--GPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLR- 432
            .||..||:  |....:...||:||.:..:.:.::|            :...:....:|.:|.|| 
  Rat   778 SSVVFYITVVGYFCVIFLLNVSMFIVVLVQLCRIK------------KKKQLGAQRKTSIQDLRS 830

  Fly   433 ---LSIVMGLTWIFNVIPYSARLHIFWEW--VGIISEYFHSAF----GIVLFV 476
               |:.::|:||.|          .|:.|  |.:...|..:.|    |..:|:
  Rat   831 IAGLTFLLGITWGF----------AFFAWGPVNLTFMYLFAIFNTLQGFFIFI 873

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 57/313 (18%)
Adgrg2NP_852031.1 GPS 566..608 CDD:280071 4/10 (40%)
7tm_4 621..871 CDD:304433 50/284 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.