DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and Adgre5

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_036055.2 Gene:Adgre5 / 26364 MGIID:1347095 Length:818 Species:Mus musculus


Alignment Length:334 Identity:66/334 - (19%)
Similarity:118/334 - (35%) Gaps:86/334 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 FWVTVDLFMEKQDYCLYRHNFDSDFPKSMWIIRHRCTSHISPGSLEI-----LIITMICFVLTIA 238
            :|.|....|....:|...|.  :.|...|      ...|:....||:     |::::||.:|.|.
Mouse   493 YWDTDGCSMNGTGFCHCNHL--TSFAILM------AQYHVQDPRLELITKVGLLLSLICLLLCIL 549

  Fly   239 VYLYIKKLRNVTGKCIVCCIVSRFI----QCLIMILDHLNLLNGI----------CSPAGYSSHF 289
            .:|.:|.:::           ||.:    .|:.:.|..:..|.|:          |.......||
Mouse   550 TFLLVKPIQS-----------SRTMVHLHLCICLFLGSIIFLVGVENEGGEVGLRCRLVAVMLHF 603

  Fly   290 FRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWSTAAIMTG----SIYIVNQIWEND- 349
            ..:|:..|:::.....:.::..:        |.......|....|..|    .:.|...:.:.| 
Mouse   604 CFLAAFCWMALEGVELYFLVVRV--------FQGQGLSTWQRCLIGYGVPLLIVAISMAVVKMDG 660

  Fly   350 --PSKWNWLPL--VGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKVKGGIN-KF 409
              .:.:.||..  .||:           |.: |||...:...|.|:|.:|...:.|....|| ..
Mouse   661 YGHATYCWLDFRKQGFL-----------WSF-SGPVAFIIFCNAAIFVITVWKLTKKFSEINPNM 713

  Fly   410 TNEEEGRINCINFDSQTYLQFLRLSIVMGLTWIFNVI---PYSARLHIFWEWVGIISEYFHSAFG 471
            ....:.|:..|...:|.        :|:|.||.|.:.   |:|.       |:..|....:...|
Mouse   714 KKLRKARVLTITSIAQL--------LVLGCTWGFGLFLFNPHST-------WLSYIFTLLNCLQG 763

  Fly   472 IVLFVLLVL 480
            :.|:|:|.|
Mouse   764 LFLYVMLCL 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 7/34 (21%)
Adgre5NP_036055.2 EGF_CA 69..118 CDD:284955
EGF_CA 165..212 CDD:284955
EGF_CA 214..248 CDD:284955
GPS 480..518 CDD:280071 6/26 (23%)
7tm_2 526..766 CDD:278432 54/285 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 799..818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.