DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and Adgrd1

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001074811.1 Gene:Adgrd1 / 243277 MGIID:3041203 Length:903 Species:Mus musculus


Alignment Length:293 Identity:51/293 - (17%)
Similarity:112/293 - (38%) Gaps:46/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 SHISPGSLEILIITMICFVLTIAVYLYIKKLRN----VTGKCIVCCIVSRFIQCLIMILDHLNLL 276
            |.||.....:.::.:...::|.||...:..:||    :........:|::     :::|...::.
Mouse   596 SSISYVGCSLSVLCLAATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQ-----VLLLISFSME 655

  Fly   277 NGI--CSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWSTAAIMTGSI 339
            .|.  |.......|:|.:.:..|:.|...|.:.::..:...:.: :.|.|....|. ..::...|
Mouse   656 PGTVPCQVLAVLLHYFFLTAFAWMLVEGLHLYSMVIKVFGSEDS-KHLYYYGIGWG-CPLLICII 718

  Fly   340 YIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKVKG 404
            .|.:.:.....|...||.|          ...::|.:: ||:|.:...|:.:.    :.:.:|..
Mouse   719 SISSSMDSYGTSDSCWLAL----------GSGAIWAFV-GPALLVIVVNIVIL----VAVTRVIS 768

  Fly   405 GINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWIFNVIPYSARLHIFWEWVGIISEYFHSA 469
            .|:..:.:..|..:.....::.....|.   ::|.:|:|.|:..|.|..:|.....|:    :|.
Mouse   769 HISTDSYKIHGDPSAFKLTAKAVAVLLP---ILGTSWVFGVLAVSDRALVFQYMFAIL----NSL 826

  Fly   470 FGIVLFVLLVL-----------KRSTWTLMMDS 491
            .|:.:|:...|           |...|:|...|
Mouse   827 QGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSS 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
Adgrd1NP_001074811.1 Laminin_G_3 <173..273 CDD:290121
GPS 539..579 CDD:280071
Stachel. /evidence=ECO:0000250|UniProtKB:Q6QNK2 575..583
7tm_4 595..831 CDD:304433 45/263 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 862..903
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.