DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and ADGRL3

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_016863418.1 Gene:ADGRL3 / 23284 HGNCID:20974 Length:1586 Species:Homo sapiens


Alignment Length:276 Identity:56/276 - (20%)
Similarity:110/276 - (39%) Gaps:64/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LIITMICFVLTIAVYLYIKKL---RNVTGKCIVCCIVSRFIQCLIMILDHLNLLNGI-------- 279
            ::::::|.::.|..:.:.:.|   ||...|.:          |:.:.:..|..|.||        
Human   953 ILLSLVCLLICIFTFCFFRGLQSDRNTIHKNL----------CISLFVAELLFLIGINRTDQPIA 1007

  Fly   280 CSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWSTAAIMTGSIYIVNQ 344
            |:......|||.:|:..|:.:.....:.:|..:...:.:.|...|.......|.|:..|..:..:
Human  1008 CAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPALIVAVSAAVDYR 1072

  Fly   345 IWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNV--------AMFALTAIYIRK 401
            .:..|  |..||.|..:.          :|.:| ||:..:...||        .||..|||    
Human  1073 SYGTD--KVCWLRLDTYF----------IWSFI-GPATLIIMLNVIFLGIALYKMFHHTAI---- 1120

  Fly   402 VKGGINKFTNEEEGRINCINF-DSQTYLQ-----FLRLSIVMGLTWIFNVIPYSARLHIFWEWVG 460
                    ...|.|.::.||: |::.:::     .:.|..::||||.|.:: |.....:...::.
Human  1121 --------LKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLM-YINESTVIMAYLF 1176

  Fly   461 IISEYFHSAFGIVLFV 476
            .|   |:|..|:.:|:
Human  1177 TI---FNSLQGMFIFI 1189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
ADGRL3XP_016863418.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.