DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and ADGRF2

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001355044.1 Gene:ADGRF2 / 222611 HGNCID:18991 Length:708 Species:Homo sapiens


Alignment Length:278 Identity:64/278 - (23%)
Similarity:108/278 - (38%) Gaps:70/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 ISPGSLEILIITMICFV------------LTIAVYLY-------IKKLRNVTGKCIVCCIVSRFI 263
            :||..||.||:|.|.:|            |:|.|.::       |..||:|       |||:  |
Human   436 MSPHILESLILTYITYVGLGISICSLILCLSIEVLVWSQVTKTEITYLRHV-------CIVN--I 491

  Fly   264 QCLIMILD----HLNLLNGI------CSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPN 318
            ...:::.|    ..:.|:|.      |..|.:..|||      :|||..:...|.|..|..:...
Human   492 AATLLMADVWFIVASFLSGPITHHKGCVAATFFVHFF------YLSVFFWMLAKALLILYGIMIV 550

  Fly   319 YRFLRYNAFVWSTAAIMTGSIYIVNQIW--ENDPSKWNWLPLVGFIR---CSVK-DWHPSVWIYI 377
            :..|..:..|.|..::..|....:..|.  ..:|.|       |::|   |.:. |...::..::
Human   551 FHTLPKSVLVASLFSVGYGCPLAIAAITVAATEPGK-------GYLRPEICWLNWDMTKALLAFV 608

  Fly   378 SGPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWI 442
            . |:||:...|  :..:|.:.::..:..|.....:|...|..|:      .....|:.::||||.
Human   609 I-PALAIVVVN--LITVTLVIVKTQRAAIGNSMFQEVRAIVRIS------KNIAILTPLLGLTWG 664

  Fly   443 FNVIPY----SARLHIFW 456
            |.|...    |...||.:
Human   665 FGVATVIDDRSLAFHIIF 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
ADGRF2NP_001355044.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.