DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and ADGRG3

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_005255899.1 Gene:ADGRG3 / 222487 HGNCID:13728 Length:596 Species:Homo sapiens


Alignment Length:222 Identity:51/222 - (22%)
Similarity:89/222 - (40%) Gaps:40/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 CSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWSTAAIM---TGS--- 338
            |...|...|:|.:.:..|:.:.::|.:.:...:......:.||:.:...|...|:|   |||   
Human   385 CWARGAVFHYFLLCAFTWMGLEAFHLYLLAVRVFNTYFGHYFLKLSLVGWGLPALMVIGTGSANS 449

  Fly   339 --IYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRK 401
              :|.:.. .||..|    |.|     |..::......:||:.....|.||...|..| |:.:.|
Human   450 YGLYTIRD-RENRTS----LEL-----CWFREGTTMYALYITVHGYFLITFLFGMVVL-ALVVWK 503

  Fly   402 VKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTW---IFNVIPYSARLHIFWEWVGIIS 463
            :      ||......:.....:.:..|..|.||.::|:||   ||..:..|. ::||        
Human   504 I------FTLSRATAVKERGKNRKKVLTLLGLSSLVGVTWGLAIFTPLGLST-VYIF-------- 553

  Fly   464 EYFHSAFGIVL---FVLLVLKRSTWTL 487
            ..|:|..|:.:   |.:|.|...:.|:
Human   554 ALFNSLQGVFICCWFTILYLPSQSTTV 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
ADGRG3XP_005255899.1 GPS 213..255 CDD:280071
7tm_4 355..564 CDD:304433 47/204 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.