DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and ADGRF5

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_005248949.1 Gene:ADGRF5 / 221395 HGNCID:19030 Length:1386 Species:Homo sapiens


Alignment Length:358 Identity:67/358 - (18%)
Similarity:118/358 - (32%) Gaps:120/358 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 WVTVDLFMEKQD----YCLYRH--NF------DSDFPKSMWIIRHRCTSHISPGSLEILIITMIC 232
            |.:...::|:.|    .|:..|  :|      ||..|.|:..|.....|::..| ..||.:. .|
Human  1008 WDSSGCYVEEGDGDNVTCICDHLTSFSILMSPDSPDPSSLLGILLDIISYVGVG-FSILSLA-AC 1070

  Fly   233 FVLTIAVYLYIKKLRN--VTGKCIV-----CCIVSRFIQCLIMILDHLNLL-NGICSPAGYSSHF 289
            .|:...|:..:.|.|.  :...|||     ..:.:.:...:..|.|:..:| ...|..|.:..||
Human  1071 LVVEAVVWKSVTKNRTSYMRHTCIVNIAASLLVANTWFIVVAAIQDNRYILCKTACVAATFFIHF 1135

  Fly   290 FRMASNLWLSVI---------------SYHTWKVLT--------------SLNRVDPNYRFLRYN 325
            |.::...|:..:               |..|.|.:.              :|....|...:.|.|
Human  1136 FYLSVFFWMLTLGLMLFYRLVFILHETSRSTQKAIAFCLGYGCPLAISVITLGATQPREVYTRKN 1200

  Fly   326 AFVWSTAAIMTGSIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVA 390
            . .|..              ||:..:      |:.|                :.|:|.:...|: 
Human  1201 V-CWLN--------------WEDTKA------LLAF----------------AIPALIIVVVNI- 1227

  Fly   391 MFALTAIYIRKV-KGGINKFTNEEEGRINCINFDSQTYLQFLR----LSIVMGLTWIFNVIPYSA 450
              .:|.:.|.|: :..|.....::|         ..:..|..:    |:.::||||.|.:.....
Human  1228 --TITIVVITKILRPSIGDKPCKQE---------KSSLFQISKSIGVLTPLLGLTWGFGLTTVFP 1281

  Fly   451 RLHIFWEWVGIISEYFHSAFGIV-----LFVLL 478
            ..::          .||..|.|:     ||:||
Human  1282 GTNL----------VFHIIFAILNVFQGLFILL 1304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 11/45 (24%)
ADGRF5XP_005248949.1 SEA 170..259 CDD:279699
IG_like 285..361 CDD:214653
IGc2 285..351 CDD:197706
IG_like 517..602 CDD:214653
GPS 994..1036 CDD:280071 6/27 (22%)
7tm_4 1051..1302 CDD:304433 53/311 (17%)
7tm_1 1070..1308 CDD:278431 52/294 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.