DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and Adgrg6

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_006512741.1 Gene:Adgrg6 / 215798 MGIID:1916151 Length:1258 Species:Mus musculus


Alignment Length:511 Identity:105/511 - (20%)
Similarity:169/511 - (33%) Gaps:146/511 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IPGCNYYDTVDISYIERQNDSYLYDDIEIPASLTGYYEFRQFGDGSITPIEKHLRACVCSVRPCI 88
            |||.|......|. :...|:||...|               ||:|...|:..             
Mouse   695 IPGTNAPSNFSIG-LPSNNESYFQMD---------------FGNGQTDPLAS------------- 730

  Fly    89 RICCPAKNFLANGKCDDGLKEELARFKPYIYFTYMDLQARVPLTDMAIIRDEFFDCD-EMIYISD 152
             :..| .|.|.|...:|.:   |.|...:.:|....|...|. :...::......|. ..|.|.:
Mouse   731 -VILP-PNLLENLSPEDSV---LVRRAQFTFFNKTGLFQDVG-SQRKVLVSYVMACSIGNITIQN 789

  Fly   153 FNYFLEEVSIQIFNKCGLIVWFQDGKFWVTVDLFMEK-------------------QDYCLYRH- 197
            ..   :.|.|:|.:.....|......||   |:...|                   :..||..| 
Mouse   790 LK---DPVQIKIKHTRTQEVHHPICAFW---DMNKNKSFGGWNTSGCVAHSDLDAGETICLCSHF 848

  Fly   198 -NFD--SDFPKSMWIIRHRCTSHISPGSLEILIITMICFV----------LTIAVYLYIKKLRNV 249
             :|.  .|.|:|...|..|.|.          ::|.|.::          .|:..|:..:|||. 
Mouse   849 THFGVLMDLPRSASQIDGRNTK----------VLTFITYIGCGISAIFSAATLLTYVAFEKLRR- 902

  Fly   250 TGKCIVCCIVSRFIQCLIMILDHLNLL------------NGICSPAGYSSHFFRMASNLWLSVIS 302
                   ...|:.:..|...|..|||:            .|:|:......|||.:|:..|:.:.:
Mouse   903 -------DYPSKILMNLSSALLFLNLIFLLDGWVTSFGVAGLCTAVAALLHFFLLATFTWMGLEA 960

  Fly   303 YHTWKVLTSLNRVDPNYRFLRYNAFVWSTAAIMTGSIYIV----NQIW--------ENDPSKWNW 355
            .|.:..|..:.....:...|::....|...|::. ||.:|    |:::        ::|...|..
Mouse   961 IHMYIALVKVFNTYIHRYILKFCIIGWGLPALVV-SIILVSRRQNEVYGKESYGKDQDDEFCWIQ 1024

  Fly   356 LPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCI 420
            .|:|.::.|             :|....:...|||||.:..:.|....|..:..|..||...|..
Mouse  1025 DPVVFYVSC-------------AGYFGVMFFLNVAMFIVVMVQICGRNGKRSNRTLREEVLRNLR 1076

  Fly   421 NFDSQTYLQFLRLSIVMGLTWIFNV-------IPYSARLHIFWEWVGIISEYFHSA 469
            :..|.|:|        :|:||.|..       ||:.....||....|:....||.|
Mouse  1077 SVVSLTFL--------LGMTWGFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCA 1124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 39/210 (19%)
Adgrg6XP_006512741.1 CUB 48..156 CDD:238001
LamG 188..347 CDD:389952
HRM 543..588 CDD:382965
GPS 809..854 CDD:366827 8/47 (17%)
7tm_GPCRs 869..1137 CDD:391938 62/296 (21%)
TM helix 1 871..896 CDD:341315 4/24 (17%)
TM helix 2 906..928 CDD:341315 6/21 (29%)
TM helix 3 939..966 CDD:341315 6/26 (23%)
TM helix 4 981..997 CDD:341315 3/16 (19%)
TM helix 5 1026..1049 CDD:341315 8/35 (23%)
TM helix 6 1072..1097 CDD:341315 8/32 (25%)
TM helix 7 1101..1126 CDD:341315 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.