DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and lat-2

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001040724.1 Gene:lat-2 / 173771 WormBaseID:WBGene00002252 Length:1338 Species:Caenorhabditis elegans


Alignment Length:267 Identity:56/267 - (20%)
Similarity:112/267 - (41%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 ITMICFVLTIAVYLYIKKLRNVTGK-----CIVCCIVSRFIQCLIMILDHLNLLNGICSPAGYSS 287
            |:::|..|::.|:.:.:.|:||...     |: |.:::..:  .::.:|......| |.......
 Worm   907 ISIVCLALSVCVFTFFRNLQNVRNSIHRNLCL-CLLIAELV--FVIGMDRTGNRTG-CGVVAILL 967

  Fly   288 HFFRMASNLWLSVISYHTWKVLTSLNRVDPN-YRFLRYNAFVWSTAAIMTGSIYIVNQIWEN--- 348
            |:|.::|..|:.:..|..:.:|..:  .:|| .|...|..|.:.|.|::......:.  ||:   
 Worm   968 HYFFLSSFCWMLLEGYQLYMMLIQV--FEPNRTRIFLYYLFCYGTPAVVVAISAGIK--WEDYGT 1028

  Fly   349 DPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEE 413
            |...|            :....|::|.::: |.:.:...|: :|.|.|:   ||...:......:
 Worm  1029 DSYCW------------IDTSTPTIWAFVA-PIIVIIAANI-IFLLIAL---KVVLSVQSRDRTK 1076

  Fly   414 EGRINCINFDSQTYLQFLR----LSIVMGLTWIFNVI-PYSARLHIFWEWVGIISEYFHSAFGIV 473
            .|||          :.:|:    |..::|:||||..: .........:.|:..|   .:...||.
 Worm  1077 WGRI----------IGWLKGSATLLCLLGITWIFGFLTAVKGGTGTAFAWIFTI---LNCTQGIF 1128

  Fly   474 LFVLLVL 480
            :|||.|:
 Worm  1129 IFVLHVV 1135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
lat-2NP_001040724.1 CLECT 52..193 CDD:214480
Gal_Lectin 242..322 CDD:280328
CLECT 330..>399 CDD:295302
HormR 479..542 CDD:214468
GAIN 556..>660 CDD:293098
GPS 837..884 CDD:197639
7tm_4 894..1129 CDD:304433 52/259 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.