Sequence 1: | NP_648181.2 | Gene: | mthl7 / 38910 | FlyBaseID: | FBgn0035847 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138640.1 | Gene: | ADGRF3 / 165082 | HGNCID: | 18989 | Length: | 1079 | Species: | Homo sapiens |
Alignment Length: | 211 | Identity: | 40/211 - (18%) |
---|---|---|---|
Similarity: | 76/211 - (36%) | Gaps: | 43/211 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 279 ICSPAGYSSHFFRMASNLWL----SVISYHTWKVLTSL--NRVDPNYRFLRYNAFVWSTAAIMTG 337
Fly 338 SIYIVNQIWENDPSKWNWLPLVGFIR---CSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYI 399
Fly 400 RKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWIFNVIPYSARLHIFWEWVGIISE 464
Fly 465 YFHSAFGIV--LFVLL 478 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mthl7 | NP_648181.2 | Mth_Ecto | 27..214 | CDD:299804 | |
ADGRF3 | NP_001138640.1 | HRM | 431..477 | CDD:280888 | |
GPS | 713..758 | CDD:280071 | |||
7tm_4 | 770..1016 | CDD:304433 | 37/207 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4193 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |