DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and ADGRF3

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001138640.1 Gene:ADGRF3 / 165082 HGNCID:18989 Length:1079 Species:Homo sapiens


Alignment Length:211 Identity:40/211 - (18%)
Similarity:76/211 - (36%) Gaps:43/211 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 ICSPAGYSSHFFRMASNLWL----SVISYHTWKVLTSL--NRVDPNYRFLRYNAFVWSTAAIMTG 337
            :|..|.:..||..:|:..|:    .|:::....|...|  :||.|....|.|...: ..|.:..|
Human   840 LCLAAAFLCHFLYLATFFWMLAQALVLAHQLLFVFHQLAKHRVLPLMVLLGYLCPL-GLAGVTLG 903

  Fly   338 SIYIVNQIWENDPSKWNWLPLVGFIR---CSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYI 399
            .                :||...::|   |.:.....:::.:: ||.||:...|..:.|:..:.:
Human   904 L----------------YLPQGQYLREGECWLDGKGGALYTFV-GPVLAIIGVNGLVLAMAMLKL 951

  Fly   400 RKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWIFNVIPYSARLHIFWEWVGIISE 464
            .:..........:.:..:..|.       ..|.|:.:.||||       ...|....|.|..:..
Human   952 LRPSLSEGPPAEKRQALLGVIK-------ALLILTPIFGLTW-------GLGLATLLEEVSTVPH 1002

  Fly   465 YFHSAFGIV--LFVLL 478
            |..:....:  :|:||
Human  1003 YIFTILNTLQGVFILL 1018

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
ADGRF3NP_001138640.1 HRM 431..477 CDD:280888
GPS 713..758 CDD:280071
7tm_4 770..1016 CDD:304433 37/207 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.