DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and CG43968

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster


Alignment Length:518 Identity:80/518 - (15%)
Similarity:159/518 - (30%) Gaps:192/518 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RQNDSYLYDDIEIPASLTGYYEFRQFGDGSI-----TPIEKHLRACVCSVRPC------IRICCP 93
            |:||..:..::.:|..     .:|:..:.|:     .|.|..|:..:.:..|.      :.:.|.
  Fly   161 RRNDELMPYEVRLPGK-----SWRKEINRSLIHLQNNPNEHCLKHTINNQTPADFKSQIVSVDCN 220

  Fly    94 A---------KNFLANGKCDDGLKEELARFKPYIYF-------TYMDLQARVPLTDMAII----- 137
            |         ...::|..|..|....:  ::|.:.:       ||..|..:..|.....:     
  Fly   221 AFLNAVCIFKSELISNAGCPSGFGALV--YQPAVCYGIDWNNTTYEPLDLKEYLKKRNWLRRILA 283

  Fly   138 -------RDEFFDCDEMIYISDFNYFLEEVSI----QIFNKCGL--------------------- 170
                   |.|||..|..|:.|....::.::|:    ||.:| ||                     
  Fly   284 KYVLKKNRHEFFKIDFFIHHSTKMEYVIKMSLSEDFQIVSK-GLKWIPTLSKQIVKSSSAVEMVL 347

  Fly   171 ----------IVWFQDGKFW----------------------VTVDLFMEKQD--YCLYRHNFDS 201
                      :|.:.....|                      |.:||..|.|:  |.:.:.|..|
  Fly   348 EIDHRSKGVRLVIYNRKYLWKNNNSYVGVKCFALLKYGTLKNVRLDLIWENQEQSYSILKVNIVS 412

  Fly   202 DFPKSMWIIRHRCTSHISPGSLEILIITMICFVLTIAVYLYIKKLRNVTGKCIVCCIVSRFIQCL 266
            .:....|     |..|   ...|..:::...||                       .|:|.|..:
  Fly   413 SYRTEYW-----CEGH---SIFEFQLVSTRLFV-----------------------DVNRSIAPV 446

  Fly   267 IMILDHLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWST 331
            .::..:::.:|.            ..|.||...|...:..|::.|:...:.....|.|:      
  Fly   447 FVLRWNVSCINA------------NFAYNLCDEVTDKNLRKLIESVYGNNNLGNLLIYD------ 493

  Fly   332 AAIMTGSIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTA 396
                   :.|:|..|..:.....|:.:...::.:...:|..:....:.|.:...          .
  Fly   494 -------VRIMNIEWIKNMCVVFWIHITATLKSTASTYHKEIAFVDNTPRIPKD----------F 541

  Fly   397 IYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLS--IVMGLTWIFNVIPYS-ARLHIFW 456
            :...|||             |...||    :|.|::.|  ::....:.|:.:.:| ..:|::|
  Fly   542 VAFMKVK-------------ITLSNF----FLNFIKNSTYLLRSTDYCFSELSFSNDGMHLWW 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 44/271 (16%)
CG43968NP_001262238.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.