DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl7 and adgrl2b.1

DIOPT Version :9

Sequence 1:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001353776.1 Gene:adgrl2b.1 / 110437953 ZFINID:ZDB-GENE-130116-4 Length:1454 Species:Danio rerio


Alignment Length:406 Identity:85/406 - (20%)
Similarity:155/406 - (38%) Gaps:94/406 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DDGLKEELARFKPYIYFTYMDLQ-ARVPLTDMAIIRDEFFDCDEMIYISDFNYFLEEVSIQIFNK 167
            |.||:........:|....::.: :||.:::..|...|..|.:        |||....|...:::
Zfish   725 DGGLRNHTLTVNSHILSASINKESSRVFVSEPVIFTLEHLDTE--------NYFNPNCSFWNYSE 781

  Fly   168 CGLIVWFQDGKFWVT--VDLFMEKQDY----CLYRHNFDSDFPKSMWIIRHRCTSHISPGSLEIL 226
            ..:      ..:|.|  ..|....:.:    |.:..||       ..::.|| .||...||:..|
Zfish   782 RSM------SGYWSTQGCKLLSTNKTHTTCSCSHLTNF-------AILMVHR-DSHAGEGSVHEL 832

  Fly   227 IIT----------MICFVLTIAVYLYIKKL---RNVTGKCIVCCIVSRFIQCLIMILDHLNLLNG 278
            ::|          ::|..::|..:.:.:.|   ||...|.:  || :.||..|:.::. :|:...
Zfish   833 LLTVITRLGIAVSLVCLAISIFTFCFFRGLQSDRNTIHKNL--CI-NLFIAELLFLVG-INMTEP 893

  Fly   279 --ICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNA-------FVWSTAAI 334
              :||......|||.:|:..|:.:.....:.:|..:...:.:.|...|.:       .|..:|||
Zfish   894 PIVCSVIAGVLHFFFLAAFSWMCLEGVQLFLMLVEVFESEFSRRKYYYASGYLFPCVVVGISAAI 958

  Fly   335 MTGSIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYI 399
            ...|.         ...|..||.:         |.| .:|.:| ||...:...|: :|.:..:| 
Zfish   959 DYKSY---------GTKKACWLRV---------DNH-FIWSFI-GPVTFIILLNL-IFLVVTMY- 1001

  Fly   400 RKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWIFNVIPYSARLHIFWEWVGIISE 464
            :.||..::  ...:..|:..|.  |..:..|..|.::. |||.|.:        :|.....:|..
Zfish  1002 KMVKHSMS--MKPDSSRLESIR--SWVFGAFALLCLLC-LTWSFGL--------LFLNDSSVIMA 1053

  Fly   465 YFHSAF----GIVLFV 476
            |..|.|    |:.:||
Zfish  1054 YLFSIFNTLQGMFIFV 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 20/116 (17%)
adgrl2b.1NP_001353776.1 Gal_Lectin 50..130 CDD:307994
OLF 139..395 CDD:321983
HormR 468..528 CDD:214468
GAIN 538..746 CDD:318649 4/20 (20%)
GPS 770..822 CDD:197639 10/65 (15%)
7tm_GPCRs 831..1088 CDD:333717 60/278 (22%)
TM helix 1 834..858 CDD:320672 3/23 (13%)
TM helix 2 867..888 CDD:320672 7/24 (29%)
TM helix 3 898..920 CDD:320672 6/21 (29%)
TM helix 4 939..955 CDD:320672 2/15 (13%)
TM helix 5 974..997 CDD:320672 8/25 (32%)
TM helix 6 1021..1046 CDD:320672 8/35 (23%)
TM helix 7 1050..1075 CDD:320672 7/20 (35%)
Latrophilin 1087..1454 CDD:308136
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.